DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and Pcdhb11

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:NP_444366.3 Gene:Pcdhb11 / 93882 MGIID:2136746 Length:797 Species:Mus musculus


Alignment Length:1033 Identity:222/1033 - (21%)
Similarity:333/1033 - (32%) Gaps:405/1033 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   795 LLYKNGINLVNNELGTYREMPSEPTS----RNIT--MGSR---FRSRNRSRSSKSKRRLPRRLVG 850
            ||:|:|..      .|...||.|..|    .|:.  :|.|   ..:|......|..:.|   |..
Mouse    22 LLWKSGSG------ATRYSMPEEKESGYLVANVAKDLGLRVGELATRGAQIHYKGNKEL---LQM 77

  Fly   851 DANIKLRYIIANQQEVVNKISITEDGTLLTLTGLDREQQPSYELTVIVEYSTGLVSGAGIYQVNI 915
            ||                     |.|.|.....||||.........::.:...|.:....:|..:
Mouse    78 DA---------------------ETGNLFLKEKLDREALCGATEPCVLHFQVILENPVQFFQTEL 121

  Fly   916 KVDDVNDNAPKFNALTYVGLINENCVVGTELSMNHAILIQDADEGPNAEFRVQLQGDYSDEFSIE 980
            ::.|:||::|:|.....:..|.||...||...:..|   ||:|.|.||   ||            
Mouse   122 QLTDINDHSPEFPDREMLLKIPENAQPGTVFPLKAA---QDSDIGSNA---VQ------------ 168

  Fly   981 YVNGTSSENSTHHKMPSTTGAFNIFNLTDQWNDEFKYQELHTTFMQTNFKLSSGPYFRISYTGKR 1045
              |.|.|.|...|.            :|...:|..||.||                     ...|
Mouse   169 --NYTVSPNIHFHV------------ITHSRSDGRKYPEL---------------------VLDR 198

  Fly  1046 GLDREKQQLYNLKIIAADTGG--LSGYAHLTVLVADVNDNAPMFERISVFKDSRLEIREYTTDME 1108
            .||||:|....|.:.|.|.|.  .||...:.:.|.|:|||||.|.:                  .
Mouse   199 ALDREEQPELTLILTALDGGAPPRSGTTIVHIEVVDINDNAPQFIQ------------------S 245

  Fly  1109 IYFVESSSGMTAPQATAAMMLAPPPYHIPGSPRFNVDRERSVGAGLGVVARAKSRRRMVRALTTK 1173
            :|.|:                                                            
Mouse   246 LYEVQ------------------------------------------------------------ 250

  Fly  1174 CPLFAIYEDTPVGTKVLQLSASDEDFGKNALLHYEL-QGEQVERTPGMPMLRVHGVKYFAIDKLS 1237
                 |.|::|:.|.|:.:||.|.|.|....:.|.| ||:.:.:.             |.||:::
Mouse   251 -----ILENSPIDTLVVTVSARDLDSGIYGNVAYSLFQGDGLSQP-------------FVIDEVT 297

  Fly  1238 GELSVNYPLS------ANIEIMLNLTVTDIDGLKDSTCLRFTVMDVNNHAPTFKKSWYSFDTPEG 1296
            ||:.::..|.      .||||    ..||...|.....:...|:|||::||.......:...||.
Mouse   298 GEIRLSKELDFEGISHYNIEI----AATDGGDLLGKCTVVIQVLDVNDNAPELMIRKLTVPVPEN 358

  Fly  1297 EYKDSVLGQLTAIDMDFGENANITYTLSDSHLPFTIKPASG---VLKIGGQLDRELKDKYSFQVI 1358
            . .::|:...:..|.|.|:|..|..:: .:::||.:||...   .|...|.||||.:.:|:..:.
Mouse   359 S-AETVVAVFSVSDSDSGDNGRIVCSI-QNNIPFLLKPTFENYYTLVTEGPLDRESRAEYNITIT 421

  Fly  1359 ATD-NAPVMQRMSSSVDVEVNVLDINDNRPEFIGYDDQTKAVKFIPSVADRTLMLPVYKAYLDRS 1422
            ..| ..|   |:::...:.|.|.|||||.|.|    .||....|:                    
Mouse   422 VWDLGTP---RLTTQHTITVQVSDINDNAPAF----TQTSYTLFV-------------------- 459

  Fly  1423 TQPGTFVRQLTAIDKDNVGNGNGLVLYSIRHQEMQAPLFQIDSRDGTISTISRINGYNDYEHLNV 1487
                                           ||..:|..||    ||||.....:|.|  .|:..
Mouse   460 -------------------------------QENNSPALQI----GTISATDSDSGSN--AHITY 487

  Fly  1488 SVIASDVGSPALSATAIVIVNLQGQAVTDPPKSTPKPEPPANVTVFQHAYYEVKLTENNEAPIEV 1552
            |::...  .|.|:..:::                                               
Mouse   488 SLLLPQ--DPQLALASLI----------------------------------------------- 503

  Fly  1553 MRLNLSAGLNPENYRWSLWLEEGLDETDAHPPFEYDAKNMLLYALKPFDREHISRYQLRIRADRL 1617
                   .:||:|.:                          |:.|:..|.|.:..::.|:.|   
Mouse   504 -------SINPDNGQ--------------------------LFVLRALDYESLQAFEFRVGA--- 532

  Fly  1618 SREARNYARVSYPVVDERIEGLSLNECRILVHIADENDNAP----KFRGNGQPIVAVLPQSASFG 1678
                          .|:....|| ::..:.|.:.|:|||||    ..:....|...:||:.|..|
Mouse   533 --------------TDQGSPALS-SQTLVRVVVLDDNDNAPFVLYPMQNASAPCTELLPREAESG 582

  Fly  1679 YPVTRVEANDLDEGLNAEIRYRLL--NEPARLFGIDELSGNI---RLLGELSRTEHIYGFDVKAT 1738
            |.||:|.|.|.|.|.||.:.::||  .||. ||.:...:|.:   |||.|....:|.....||  
Mouse   583 YLVTKVVAVDRDSGQNAWLSFQLLKATEPG-LFSVWAHNGEVRTTRLLSERDVPKHRLLLLVK-- 644

  Fly  1739 DRMGADDGR---SGIVNVFVYIINEAKQVRLVVAGMPVEVERRIEGLMEALSDAIGKD 1793
                 |:|.   |..|.:.|.::|...|..|              .|.|...|.|.:|
Mouse   645 -----DNGEPQLSASVTLQVLLVNSFSQPYL--------------SLPEVAQDPIQED 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520 14/73 (19%)
CA 1026..1085 CDD:214520 17/60 (28%)
Cadherin_repeat 1177..1280 CDD:206637 31/109 (28%)
Cadherin_repeat 1289..1385 CDD:206637 27/99 (27%)
Cadherin_repeat 1414..1510 CDD:206637 15/95 (16%)
CA 1576..1658 CDD:214520 14/81 (17%)
Cadherin_repeat 1666..1760 CDD:206637 34/101 (34%)
Pcdhb11NP_444366.3 Cadherin_2 32..112 CDD:285466 21/103 (20%)
Cadherin_repeat 140..238 CDD:206637 40/150 (27%)
Cadherin_repeat 247..342 CDD:206637 33/176 (19%)
Cadherin_repeat 352..446 CDD:206637 27/98 (28%)
Cadherin_repeat 454..556 CDD:206637 31/258 (12%)
Cadherin_repeat 575..662 CDD:206637 33/94 (35%)
Cadherin_C_2 687..769 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.