DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and PCDHB16

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:NP_066008.2 Gene:PCDHB16 / 57717 HGNCID:14546 Length:776 Species:Homo sapiens


Alignment Length:986 Identity:209/986 - (21%)
Similarity:333/986 - (33%) Gaps:375/986 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   807 ELGTYREMPSEPTSRNITMGSRFRSRNRSRSSKSKRRLPRRLVGDANIKLRYIIANQQEVVNKIS 871
            |||:|..:  |.|.|...:.:..:......:..|.|:  .|::..         .|:|.:..|  
Human    29 ELGSYSVV--EETERGSFVANLGKDLGLGLTEMSTRK--ARIISQ---------GNKQHLQLK-- 78

  Fly   872 ITEDGTLLTLTGLDREQQPSYELTVIVEYSTGLVSGAGIYQVNIKVDDVNDNAPKFNALTYVGLI 936
             .:.|.||....||||:........|:.:...:.:...|:|..::|.|:||::|.|.....:..|
Human    79 -AQTGDLLINEKLDREELCGPTEPCILHFQVLMENPLEIFQAELRVIDINDHSPMFTEKEMILKI 142

  Fly   937 NENCVVGTELSMNHAILIQDADEGPNAEFRVQLQGDYSDEFSIEYVNGTSSENSTHHKMPSTTGA 1001
            .||..:|||..:|||:   |.|.|.|                          |..::|: |.:..
Human   143 PENSPLGTEFPLNHAL---DLDVGSN--------------------------NVQNYKI-SPSSH 177

  Fly  1002 FNIFNLTDQWNDEFKYQELHTTFMQTNFKLSSGPYFRISYTGKRGLDREKQQLYNLKIIAADTGG 1066
            |.:  |..::.|..||.||                     ...:.||||::....|.:.|.|.|.
Human   178 FRV--LIHEFRDGRKYPEL---------------------VLDKELDREEEPQLRLTLTALDGGS 219

  Fly  1067 --LSGYAHLTVLVADVNDNAPMFERISVFKDSRLEIREYTTDMEIYFVESSSGMTAPQATAAMML 1129
              .||.|.:.:.|.|:|||||.||:                  .||.|:                
Human   220 PPRSGTAQVRIEVVDINDNAPEFEQ------------------PIYKVQ---------------- 250

  Fly  1130 APPPYHIPGSPRFNVDRERSVGAGLGVVARAKSRRRMVRALTTKCPLFAIYEDTPVGTKVLQLSA 1194
                  ||                                           |::|:|:.|..:||
Human   251 ------IP-------------------------------------------ENSPLGSLVATVSA 266

  Fly  1195 SDEDFGKNALLHYEL--QGEQVERTPGMPMLRVHGVKYFAIDKLSGEL----SVNYPLSANIEIM 1253
            .|.|.|.|..:.|.|  ..|.:.:|             ..::.::||:    .|::.:..:.|: 
Human   267 RDLDGGANGKISYTLFQPSEDISKT-------------LEVNPMTGEVRLRKQVDFEMVTSYEV- 317

  Fly  1254 LNLTVTDIDGLKDSTCLRFTVMDVNNHAPTFKKSWYSFDTPEGEYKDSVLGQLTAIDMDFGENAN 1318
             .:..||..||.....|...|:|||::.|....|..:...||.. .:.|:...:..|.|.|.|..
Human   318 -RIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMSALTSPIPENS-PEIVVAVFSVSDPDSGNNGK 380

  Fly  1319 ITYTLSDSHLPFTIKPASG---VLKIGGQLDRELKDKYSFQVIATD-NAPVMQRMSSSVDVEVNV 1379
            ...::.:. |||.:||:..   .|.....||||.:.:|:..:..|| ..|   |:.:..::.|.:
Human   381 TISSIQED-LPFLLKPSVKNFYTLVTERALDREARAEYNITLTVTDMGTP---RLKTEHNITVQI 441

  Fly  1380 LDINDNRPEFIGYDDQTKAVKFIPSVADRTLMLPVYKAYLDRSTQPGTFVRQLTAIDKDNVGNGN 1444
            .|:|||.|.|    .||.                 |..::..:..|...:..::|.|:|:  ..|
Human   442 SDVNDNAPTF----TQTS-----------------YTLFVRENNSPALHIGSVSATDRDS--GTN 483

  Fly  1445 GLVLYSIRHQEMQAPLFQIDSRDGTISTISRINGYNDYEHLNVSVIASDVGSPALSATAIVIVNL 1509
            ..|.||:           :..:|                             |.|...::|.:| 
Human   484 AQVTYSL-----------LPPQD-----------------------------PHLPLASLVSIN- 507

  Fly  1510 QGQAVTDPPKSTPKPEPPANVTVFQHAYYEVKLTENNEAPIEVMRLNLSAGLNPENYRWSLWLEE 1574
                                                                             
Human   508 ----------------------------------------------------------------- 507

  Fly  1575 GLDETDAHPPFEYDAKNMLLYALKPFDREHISRYQLRIRA-DR----LSREARNYARVSYPVVDE 1634
                          |.|..|:||:..|.|.:..::.|:.| ||    |||||.            
Human   508 --------------ADNGHLFALRSLDYEALQAFEFRVGATDRGSPALSREAL------------ 546

  Fly  1635 RIEGLSLNECRILVHIADENDNAP----KFRGNGQPIVAVLPQSASFGYPVTRVEANDLDEGLNA 1695
                     .|:||  .|.|||:|    ..:....|...::|::|..||.||:|.|.|.|.|.||
Human   547 ---------VRVLV--LDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNA 600

  Fly  1696 EIRYRLL--NEPARLFGIDELSGNIRLLGELSRTEHIYGFDVKATDRMGA---DDG---RSGIVN 1752
            .:.|:||  .||. |||:...:|.:|....||..:       .|..|:..   |:|   ||....
Human   601 WLSYQLLKATEPG-LFGVWAHNGEVRTARLLSERD-------AAKQRLVVLVKDNGEPPRSATAT 657

  Fly  1753 VFVYIINEAKQ 1763
            :.|.:::...|
Human   658 LHVLLVDGFSQ 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520 17/73 (23%)
CA 1026..1085 CDD:214520 16/60 (27%)
Cadherin_repeat 1177..1280 CDD:206637 27/108 (25%)
Cadherin_repeat 1289..1385 CDD:206637 25/99 (25%)
Cadherin_repeat 1414..1510 CDD:206637 14/95 (15%)
CA 1576..1658 CDD:214520 23/86 (27%)
Cadherin_repeat 1666..1760 CDD:206637 33/101 (33%)
PCDHB16NP_066008.2 Cadherin_2 32..112 CDD:285466 18/95 (19%)
Cadherin_repeat 137..238 CDD:206637 37/153 (24%)
Cadherin_repeat 246..343 CDD:206637 32/176 (18%)
Cadherin_repeat 356..447 CDD:206637 25/95 (26%)
Cadherin_repeat 455..557 CDD:206637 35/263 (13%)
Cadherin_repeat 576..664 CDD:206637 32/95 (34%)
Cadherin_C_2 685..768 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.