DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and cdhr5-rs

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:XP_021330929.1 Gene:cdhr5-rs / 561298 ZFINID:ZDB-GENE-130530-920 Length:765 Species:Danio rerio


Alignment Length:475 Identity:132/475 - (27%)
Similarity:212/475 - (44%) Gaps:71/475 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FIRLREDAQVGKEILRLQAYPRSTAALKGADASGDHKYFNLTEHNATTL-----VVSLARSLERL 134
            |..:||::..|:.|..|        ::.|..|........||..||...     .:.|..|..|.
Zfish    33 FATVRENSPTGEFIANL--------SINGDPAGASSIRLCLTGENADWFYLEGRTIRLNSSFSRA 89

  Fly   135 VDRDVPRNLLKFRILCAGKQEKLEEGSYLSITVYIEDVNDNAPEFLNVPYVVD------VDENTS 193
            :||:|..::|...:.|  .:.::..|.| .|.|.|.:.|||.|.|:.     |      :.|..|
Zfish    90 LDREVLGSVLIAALTC--YENEIIRGRY-RIMVEILNENDNMPHFIE-----DTIQPRYISELLS 146

  Fly   194 IESIIFEGVQAFDRDKPNTPNSEVHFSMSTVPEQLSADGSPYFALKSPHRPLLILKRELDFDNGI 258
            :.|::|. |:|.|.| .:|....|..|.:.|| .:..|.| ||.:..|:..::||.:.||::.. 
Zfish   147 VNSMVFT-VKARDVD-GDTITYMVDKSTNCVP-LIKTDAS-YFRIDLPNSGMVILDKPLDYETK- 206

  Fly   259 RQFKLPIFAWDRGTPANQANT-TITINVRDVDDLPPKF---------------TEGVYRTRINEF 307
            .|.::.|:|.:..|....:.| |:|:||.|.||..|:|               |..||...|.| 
Zfish   207 TQLQVVIYAVETSTKEKYSTTATVTVNVLDGDDQYPQFQPCAPVYEDGDHNICTNPVYSVNITE- 270

  Fly   308 YPMTGVPIRIPLYFAP-PIMAFDQD-SLNASLVYDIISGNERQLFRVNPHNGVMYLQKEIDLEEE 370
                 ......|||:| ||:|.|.| ::...|||.|:||::...|.::...|.:.|:..:   |.
Zfish   271 -----TDEDAVLYFSPGPILAEDGDKNILTPLVYSILSGDDNGRFTIDSKTGEITLRHRV---EN 327

  Fly   371 SLPGNTFVLQLEARQKDNPLKKALARIEVEVLDLNDNVPEFEADYYNISIVEN-----LPT--GF 428
            .|...:|.|::.|.|.::|.|.::|...:.||..|...|.|....|...::|:     |.|  |.
Zfish   328 RLLTPSFRLRIMAAQVNDPKKYSVATALIHVLSENRFPPFFNKTVYKGFLIESSSPATLVTTYGN 392

  Fly   429 SVLQVNAVDRD--QGENSEFLYNLVETKDAAGAFRIDSRTGWITVRDDRL--LDREQRRSIQLNV 489
            .||.|.|:|||  .|.|.:..|.:.....::..:.| ::.|.:..:.|||  .||.....|..:.
Zfish   393 QVLLVQAIDRDFRDGINPKLRYTMQPLTGSSKLYHI-TQDGIVIAKTDRLRAFDRHILEVIATDE 456

  Fly   490 EALERNPSYLDDKHLKKPGP 509
            |:.|...:.:|.:.|::..|
Zfish   457 ESGEAAHASVDIEVLQRGQP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637 33/113 (29%)
Cadherin_repeat 325..407 CDD:206637 25/82 (30%)
Cadherin_repeat 416..524 CDD:206637 28/105 (27%)
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520
CA 1026..1085 CDD:214520
Cadherin_repeat 1177..1280 CDD:206637
Cadherin_repeat 1289..1385 CDD:206637
Cadherin_repeat 1414..1510 CDD:206637
CA 1576..1658 CDD:214520
Cadherin_repeat 1666..1760 CDD:206637
cdhr5-rsXP_021330929.1 Cadherin_repeat 140..239 CDD:206637 32/103 (31%)
Cadherin_repeat 263..362 CDD:206637 33/107 (31%)
Cadherin_repeat 372..471 CDD:206637 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.