DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and PCDHB11

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:NP_061754.1 Gene:PCDHB11 / 56125 HGNCID:8682 Length:797 Species:Homo sapiens


Alignment Length:835 Identity:199/835 - (23%)
Similarity:302/835 - (36%) Gaps:290/835 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1167 VRALTTKCPLFA-------IYEDTPVGTKVLQLSASDEDFGKNALLHYELQGEQVERTPGMPMLR 1224
            ||.:....|:|:       |.|::|||...|..||.|.|.|.||:..|.:.          |...
Human   123 VRDINDHSPIFSEKQMLLEIPENSPVGAVFLLESAKDLDVGINAVKSYTIS----------PNSH 177

  Fly  1225 VHGVKYFAI--DKLSGELSVNYPLSANIEIMLNLTVTDIDG---LKDSTCL-RFTVMDVNNHAPT 1283
            .| :|...|  ::...||.::..|.......|:..::.:||   .:..|.| |..|:|:|:::|.
Human   178 FH-IKMRVIPDNRKYPELVLDKALDYEELPELSFILSALDGGSPPRSGTALVRVVVVDINDNSPE 241

  Fly  1284 FKKSWYSFDTPEGEYKDSVLGQL----TAIDMDFGENANITYTLS----DSHLPFTIKPASGVLK 1340
            |::::|.....|    :|:||.|    :|.|:|.|.|..|.||.|    |....|.|...||.:.
Human   242 FEQAFYEVKIRE----NSILGSLILIVSAWDLDSGTNGEICYTFSHASEDIRKTFEINQKSGEIT 302

  Fly  1341 IGGQLDRELKDKYSFQVIATDNAPVMQRMSSSVDVEVNVLDINDNRPEFIGYDDQTKAVKFIPSV 1405
            :...||.|..:.||..:.|||...:..:.:    |.::|:|:|||.||.              :|
Human   303 LRAPLDFETIESYSIIIQATDGGGLFGKST----VIIHVIDVNDNAPEI--------------TV 349

  Fly  1406 ADRTLMLPVYKAYLDRSTQPGTFVRQLTAIDKDNVGNGNGLVLYSIRHQ---------------E 1455
            :..|..:|        ...|.|.|...:..|.|:  ..||.::.||...               |
Human   350 SSITSPIP--------ENTPETVVMVFSIQDIDS--GDNGRIVCSIPEDLPFVLKSSVENYYTLE 404

  Fly  1456 MQAPLFQIDSRDGTISTISRINGYNDYEHLNVSVIASDVGSPALSA---TAIVIVNLQGQAVTDP 1517
            .:.||    .|:.|.          :|   |:::..:|:|.|.|..   |.:::.::...|.|  
Human   405 TERPL----DRESTA----------EY---NITITVTDLGIPRLKTEHNTTVLVSDVNDNAPT-- 450

  Fly  1518 PKSTPKPEPPANVTVFQHAYYEVKLTENNEAPIEVMRLNLS---AGLNPE-NYRWSLWLEEGLDE 1578
                           |....|.:.:.|||...:.:..::.:   :|.|.: ||  ||     |..
Human   451 ---------------FTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVNY--SL-----LPP 493

  Fly  1579 TDAHPPF----EYDAKNMLLYALKPFDREHISRYQLRIRADRLSREARNYARVSYPVVDERIEGL 1639
            .|.|.|.    ..:..|..|:||:..|.|.:..:..|:.|                 .|.....|
Human   494 QDLHLPLASLVSINTDNGHLFALRSLDYEALQAFDFRVGA-----------------TDRGSPAL 541

  Fly  1640 SLNECRILVHIADENDNAP----KFRGNGQPIVAVLPQSASFGYPVTRVEANDLDEGLNAEIRYR 1700
            | :|..:.|.:.|.|||:|    ..:....|...::|::|..||.||:|.|.|.|.|.||.:.|:
Human   542 S-SEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQ 605

  Fly  1701 LL--NEPARLFGIDELSGNI---RLLGELSRTEHIYGFDVKATDRMGADDGRSGIVNVFVYIINE 1760
            ||  .||. |||:...:|.:   |||.|....:|                               
Human   606 LLKATEPG-LFGVWAHNGEVRTARLLSERDAAKH------------------------------- 638

  Fly  1761 AKQVRLVVAGMPVEVERRIEGLMEALSDAIGKDVRVRLLEPYSGGLEPATNAYIYAVDPHTNSIM 1825
                ||||                     :.||         :|  ||..:|             
Human   639 ----RLVV---------------------LVKD---------NG--EPPRSA------------- 654

  Fly  1826 EMEQLQDALAGLQLDALQLQQQKLDGGK----PMPRILELAEFGQLARPAHASASSFMGGLEFVT 1886
                           ...||...:||..    |:|.          |.||.|.|.|    |....
Human   655 ---------------TATLQVLLVDGFSQPYLPLPE----------AAPAQAQADS----LTVYL 690

  Fly  1887 VVLLALISLGALIAACCYVCMRQKRRLWSQRDFSASDAGLTYTIAGIGS---PRG 1938
            ||.||.:|...|.:...:|.:|..||         |.|      |.:||   |:|
Human   691 VVALASVSSLFLFSVLLFVAVRLCRR---------SRA------ASVGSCSVPKG 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520
CA 1026..1085 CDD:214520
Cadherin_repeat 1177..1280 CDD:206637 31/115 (27%)
Cadherin_repeat 1289..1385 CDD:206637 32/103 (31%)
Cadherin_repeat 1414..1510 CDD:206637 21/113 (19%)
CA 1576..1658 CDD:214520 21/85 (25%)
Cadherin_repeat 1666..1760 CDD:206637 28/98 (29%)
PCDHB11NP_061754.1 Cadherin_2 30..112 CDD:311943
Cadherin_repeat 140..238 CDD:206637 30/108 (28%)
Cadherin_repeat 247..343 CDD:206637 32/103 (31%)
Cadherin_repeat 356..447 CDD:206637 22/117 (19%)
Cadherin_repeat 455..557 CDD:206637 29/126 (23%)
Cadherin_repeat 576..664 CDD:206637 39/183 (21%)
Cadherin_C_2 685..768 CDD:318652 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.