DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and cdh11

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:NP_001015858.1 Gene:cdh11 / 548575 XenbaseID:XB-GENE-483599 Length:794 Species:Xenopus tropicalis


Alignment Length:767 Identity:180/767 - (23%)
Similarity:276/767 - (35%) Gaps:250/767 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   780 HFHVEENVVGGIIGQLLYKNGINLVNNELGTYREMPSEPTSRNITMGSRFRSRNRSRSSKSKRRL 844
            |.|.|:    |..||:|:::....|.|:.....|.    |..:..:..|..|...|         
 Frog    36 HGHHEK----GKEGQVLHRSKRGWVWNQFFVIEEY----TGPDPVLVGRLHSDVDS--------- 83

  Fly   845 PRRLVGDANIKLRYIIANQQEVVNKISITED--GTLLTLTGLDREQQPSYEL---TVIVEYSTGL 904
                 ||.  |::||::.  |....|.:.:|  |.:.....||||::..|.|   .|..|.:..|
 Frog    84 -----GDG--KIKYILSG--EGAGTIFVIDDKSGNIHATKTLDREERAQYTLMAQAVDRETNKPL 139

  Fly   905 VSGAGIYQVNIKVDDVNDNAPKFNALTYVGLINENCVVGTELSMNHAILIQDADEGPNAEFRVQL 969
            ...:   :..:||.|:|||.|:|....|...:.|...|||.:..   :...|||: |.       
 Frog   140 EPPS---EFIVKVQDINDNPPEFLHENYHANVPEMSNVGTSVIQ---VTASDADD-PT------- 190

  Fly   970 QGDYSDEFSIEYVNGTSSENSTHHKMPSTTGAFNIFNLTDQWNDEFKYQELHTTFMQTNFKLSSG 1034
               |.:...:.|   :..|...:..:.:.||                                  
 Frog   191 ---YGNSAKLVY---SILEGQPYFSVEAQTG---------------------------------- 215

  Fly  1035 PYFRISYTGKRGLDREKQQLYNLKIIAAD----TGGLSGYAHLTVLVADVNDNAPMFERISVFKD 1095
                |..|....:|||.::.|::.|.|.|    .|||||...:|:.:.|||||.|.|        
 Frog   216 ----IIRTALPNMDREAKEEYHVVIQAKDMGGHMGGLSGTTKVTITLTDVNDNPPKF-------- 268

  Fly  1096 SRLEIREYTTDMEIYFVESSSGMTAPQATAAMMLAPPPYHIPGSPRFNVDRERSVGAGLGVVARA 1160
                                     ||:...|                                 
 Frog   269 -------------------------PQSAYPM--------------------------------- 275

  Fly  1161 KSRRRMVRALTTKCPLFAIYEDTPVGTKVLQLSASDEDFGKNALLHYE-LQGEQVERTPGMPMLR 1224
                             ::.|....|.:|.::.|.|.|.|:|.|:.|. |:|:      |..|..
 Frog   276 -----------------SVSEAAVPGEEVGRIKAKDPDIGENGLIKYRILEGD------GAEMFE 317

  Fly  1225 V-------HGVKYFAIDKLSGELSVNYPLSANIEIMLNLTVTDID-------GLKDSTCLRFTVM 1275
            :       .||  ..:.|:     |:|.......:.:......||       ..||:..::.:|.
 Frog   318 ITADYQTQEGV--VKLKKV-----VDYETKKFYSMKVEAVNVHIDPRFLSRGPFKDTATVKISVE 375

  Fly  1276 DVNNHAPTFKKSWYSFDTPEGEYKDSVLGQLTAIDMDFGENANITYTLSDSHLP----FTIKPAS 1336
            |. :..|.|.:..|.|:..|....|:|:|::.|.|.| ..|:.|.|:: |.|..    |:|.|..
 Frog   376 DF-DEPPIFLEHIYIFEVYENAPSDTVVGRVHAKDPD-AANSPIRYSI-DRHTDLDRFFSINPED 437

  Fly  1337 GVLKIGGQLDRELKDKYSFQVIATDNAPVMQRM-SSSVDVEVNVLDINDNRPEFIGYDDQTKAVK 1400
            ||:|....||||....::..||||:   :..|: .:.|.|.:.|||.|||.|||        |..
 Frog   438 GVIKTTKGLDREESSWHNISVIATE---LHNRIHETRVPVAIKVLDKNDNAPEF--------AKP 491

  Fly  1401 FIPSVADRTLMLPVYKAYLDRSTQPGTFVRQLTAIDKDNVGNGNGLVLY-----SIRHQEMQAPL 1460
            :...|.:..   |:.:.:|           .:||||||:  ..|||..:     .|.|..   |.
 Frog   492 YEAFVCENA---PINQEFL-----------TITAIDKDD--TANGLRFFFSFPPEIVHPN---PN 537

  Fly  1461 FQI-DSRDGTIS-TISR-INGYNDYEHLNVSVIASDVGSPALSATAIVIVNL 1509
            |.| |.||.|.| .:.| :......:...|.|:.||.|||.:|:|..:.|.:
 Frog   538 FTIVDKRDNTASIRVGRGVFSRQKQDLYLVPVVISDGGSPPMSSTNTLSVRI 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520 23/78 (29%)
CA 1026..1085 CDD:214520 20/62 (32%)
Cadherin_repeat 1177..1280 CDD:206637 25/117 (21%)
Cadherin_repeat 1289..1385 CDD:206637 35/100 (35%)
Cadherin_repeat 1414..1510 CDD:206637 31/104 (30%)
CA 1576..1658 CDD:214520
Cadherin_repeat 1666..1760 CDD:206637
cdh11NP_001015858.1 CA 79..157 CDD:214520 26/98 (27%)
Cadherin_repeat 164..264 CDD:206637 32/154 (21%)
Cadherin_repeat 273..376 CDD:206637 25/165 (15%)
Cadherin_repeat 387..484 CDD:206637 35/101 (35%)
Cadherin_repeat 491..590 CDD:206637 33/118 (28%)
Cadherin_C 638..787 CDD:366437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11590
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.