DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and Pcdhga2

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:NP_001032216.1 Gene:Pcdhga2 / 498846 RGDID:1587259 Length:931 Species:Rattus norvegicus


Alignment Length:987 Identity:218/987 - (22%)
Similarity:331/987 - (33%) Gaps:394/987 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   763 QKVP----------LRPVIEEINMNVIHFHVEENV-VGGIIGQLLYKNGINLVNNELGTYREMPS 816
            ||:|          |...:.|.....|.:.|.|.: .|..:|.:....|:.            |.
  Rat     5 QKLPQSRMLVLLCALWAALWEARAGQIRYSVPEEIDKGSFVGSIAKDLGLE------------PR 57

  Fly   817 EPTSRNITMGSRFRSRNRSRSSKSKRRLPRRLVGDANIKLRYIIANQQEVVNKISITEDGTLLTL 881
            ....|.:.:.||.:|:..:.:.:|                                   |:|:|.
  Rat    58 ALEERGVRIVSRGKSQLFALNPRS-----------------------------------GSLVTA 87

  Fly   882 TGLDREQQPSYELTVIVEYSTGLVSGAGIYQVNIKVDDVNDNAPKFNALTYVGLINENCVVGTEL 946
            ..:|||:..:.....:|.::..:.....||.|.::|.|||||||:|........|:|....|..:
  Rat    88 GRIDREELCAQSTPCLVNFNLLMEDKLTIYSVEVEVIDVNDNAPRFGVEEPELKISETTTPGFRI 152

  Fly   947 SMNHAILIQDADEGPNAEFRVQLQGDYSDEFSIEYVNGTSSENSTHHKMPSTTGAFNIFNLTDQW 1011
            .:..|   .|||.|.|...:.:|..  :|.||::.                .|||          
  Rat   153 PLKSA---HDADVGENTLQKYKLNS--NDHFSLDV----------------RTGA---------- 186

  Fly  1012 NDEFKYQELHTTFMQTNFKLSSGPYFRISYTGKRGLDREKQQLYNLKIIAADTGG--LSGYAHLT 1074
             |..||.||                     ..:|.||||::.:::|.::|:|.|.  .|....:.
  Rat   187 -DGNKYPEL---------------------VLERALDREEEAVHHLVLVASDRGKPVRSSTCRIR 229

  Fly  1075 VLVADVNDNAPMFERISVFKDSRLEIREYTTDMEIYFVESSSGMTAPQATAAMMLAPPPYHIPGS 1139
            |.|.|||||||:|.:                                          |.|.:   
  Rat   230 VKVLDVNDNAPVFTQ------------------------------------------PEYRV--- 249

  Fly  1140 PRFNVDRERSVGAGLGVVARAKSRRRMVRALTTKCPLFAIYEDTPVGTKVLQLSASDEDFGKNAL 1204
                                                  ::.|:.||||::|.::|:|.|.|.||.
  Rat   250 --------------------------------------SVPENMPVGTRILTVTATDTDEGYNAQ 276

  Fly  1205 LHYELQGEQVERTPGMPMLRVHGVKYFAIDKLSGEL----SVNYPLSANIEIMLNLTVTDIDGLK 1265
            :.|.|     ||.||      .....|.:...||::    |::|..:...||  ::...|..||.
  Rat   277 VTYFL-----ERVPG------ESTDAFELKSTSGDITITKSLDYEKAKFHEI--DIEAQDGPGLL 328

  Fly  1266 DSTCLRFTVMDVNNHAPTFKKSWYSFDTPEGEYKDSVLGQLTAI----DMDFGENANITYTLSDS 1326
            ..|.:..||:|||::||.|..:..:...||    |:.||.:.|:    |.|.|:||.:|.:|.:.
  Rat   329 TRTKVIVTVLDVNDNAPEFYMTSATASVPE----DAPLGTVIALFNVHDRDSGQNAVVTCSLPEM 389

  Fly  1327 HLPFTIKPASG---VLKIGGQLDRELKDKYSFQVIATDNAPVMQRMSSSVDVEVNVLDINDNRPE 1388
             |||.::.:..   .|.....||||....|:..:.|.|..  ...:|:...:.:.|.|||||.|.
  Rat   390 -LPFKLERSVDNYYRLVTTRALDREQFSFYNITLRAKDQG--SPSLSTDAHLLLQVADINDNPPS 451

  Fly  1389 FIGYDDQTKAVKFIPSVADRTLMLPVYKAYLDRSTQPGTFVRQLTAIDKDNVGNGNGLVLYSIRH 1453
            |                     ....|.||:..:...||.:..:.|.|.|:  |.|..|.||:..
  Rat   452 F---------------------SRGAYSAYIPENNPRGTSIFSVLAYDPDS--NDNAHVTYSLAE 493

  Fly  1454 QEMQ-APL---FQIDSRDGTISTISRINGYNDYEHLNVSVIASDVGSPALSATAIVIVNLQGQAV 1514
            ...| |||   ..|:|..|.:..: |...|..::.|.:.|||.|.|.|.||              
  Rat   494 DTFQGAPLSSYISINSDTGVLYAL-RSFDYEQFQDLQLWVIAVDSGKPPLS-------------- 543

  Fly  1515 TDPPKSTPKPEPPANVTVFQHAYYEVKLTENNEAPIEVMRLNLSAGLNPENYRWSLWLEEGLDET 1579
                         :||::                                    ||:|   :|:.
  Rat   544 -------------SNVSL------------------------------------SLFL---VDQN 556

  Fly  1580 DAHPPFEYDAKNMLLYALKPFDREHISRYQLRIRADRLSREARNYARVSYPVVDERIEGLSLNEC 1644
            |..|.        :||...|.|                                           
  Rat   557 DNMPE--------ILYPALPTD------------------------------------------- 570

  Fly  1645 RILVHIADENDNAPKFRGNGQPIVAVLPQSASFGYPVTRVEANDLDEGLNAEIRYRLL--NEPAR 1707
                               |...|.:.|:||..||.||:|.|.|.|.|.||.:.||||  :||. 
  Rat   571 -------------------GSTGVELAPRSAEPGYLVTKVVAVDKDSGQNAWLSYRLLKASEPG- 615

  Fly  1708 LFGIDELSGNIR 1719
            ||.:...:|.:|
  Rat   616 LFSVGLHTGEVR 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520 16/73 (22%)
CA 1026..1085 CDD:214520 17/60 (28%)
Cadherin_repeat 1177..1280 CDD:206637 34/106 (32%)
Cadherin_repeat 1289..1385 CDD:206637 29/102 (28%)
Cadherin_repeat 1414..1510 CDD:206637 31/99 (31%)
CA 1576..1658 CDD:214520 7/81 (9%)
Cadherin_repeat 1666..1760 CDD:206637 25/56 (45%)
Pcdhga2NP_001032216.1 Cadherin_2 30..112 CDD:285466 19/128 (15%)
Cadherin_repeat 139..238 CDD:206637 36/151 (24%)
Cadherin_repeat 246..343 CDD:206637 35/150 (23%)
Cadherin_repeat 353..448 CDD:206637 29/101 (29%)
Cadherin_repeat 457..558 CDD:206637 37/169 (22%)
Cadherin_repeat 579..666 CDD:206637 24/50 (48%)
Cadherin_C_2 688..772 CDD:293101
Cadherin_tail 808..>904 CDD:292596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.