DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and Cdhr1

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:NP_570948.1 Gene:Cdhr1 / 170677 MGIID:2157782 Length:859 Species:Mus musculus


Alignment Length:773 Identity:188/773 - (24%)
Similarity:304/773 - (39%) Gaps:181/773 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VFGLIAIGQAAKTGQVQASSGSCAFHTLD-GVAAESEGVRFIRLREDAQVGKEILRLQAYPRSTA 99
            |.||:         ::..:..:.|.|..| ||.:.:..:....|.||..||..:.          
Mouse    10 VLGLL---------RIYLAQANFAPHFFDNGVGSTNGNMALFSLPEDTPVGSHVY---------- 55

  Fly   100 ALKGADASGDHKYFNLTEHNATTLVVSLARSLERL-----VDRDVPRNLLKFRILCAGKQEKLE- 158
            .|.|.|..||...::::...:|..|.|:..:...:     :||:              :::::| 
Mouse    56 TLNGTDPEGDPISYHISFDPSTRSVFSVDPNFGNITLVEELDRE--------------REDEIEA 106

  Fly   159 -----EGSYL---SITVYIEDVNDNAPEFLNVPYVVDVDENTSIESIIFEGVQAFDRDKPNTPNS 215
                 :|..|   .:.:.:.|.||.||.|:..||::.|.||....|.||: |||.|:|       
Mouse   107 IISISDGLNLVAEKVVILVTDANDEAPRFIQEPYIIRVPENIPAGSSIFK-VQAEDKD------- 163

  Fly   216 EVHFSMSTVPEQLSADGSPYFALKSPHRPLLILKRE-----------LDFDNGIRQFKLPIFAWD 269
                        ..:.||..::|::.|.....:.|.           ||::.. |...:.:.|.|
Mouse   164 ------------TGSGGSVTYSLQNLHSSKFSMDRHSGVLRLQAGATLDYEKS-RAHYITVIAKD 215

  Fly   270 RGTPAN------QANTTITINVRDVDDLPPKFTEGVYRTRINEFYPMTGVPIRIPLYFAPPIMAF 328
            .|....      .|.||:||||.||.|..|.|....|...:.|        ..:|......::|.
Mouse   216 GGGRLRGADMVFSATTTVTINVEDVQDTAPIFVGTPYYGYVYE--------DTLPGSEVLTVVAI 272

  Fly   329 DQDSLNAS-LVYDIISGNERQLFRVNPHNG-VMYLQKEIDLEEESLPGNTFVLQL-----EARQK 386
            |.|....: ::|.:::.:: .:|.:|..:| :..||....|..|       |.:|     |....
Mouse   273 DGDRGKPNHILYRLLNESD-GIFEINETSGAISVLQSPALLRRE-------VYELHVQVTEVNSP 329

  Fly   387 DNPLKKALARIEVEVLDLNDNVPEFEAD-----YYNISIVENLPTG--FSVLQVNAVDRDQGENS 444
            .:|..:|...:.:.::|||::.|.|..:     .:.:|:.|:.|.|  ...|::...|.|||.|:
Mouse   330 GSPAAQATVPVTIRIVDLNNHPPTFYGESGPQNKFELSMFEHPPQGEILRGLKITVNDSDQGANA 394

  Fly   445 EFLYNLVETKDAAGAFRIDSRT------GWITVRDDRLLDREQRRSIQLNVEALERN-PSYLDDK 502
            :|...||   ...|.||:..:|      ..|.|.:...:|.|:.:.:...:.|:|.| |....  
Mouse   395 KFNLRLV---GPGGIFRVVPQTVLNEAQVTIIVENSAAIDFEKSKLLTFKLLAIEVNTPEKFS-- 454

  Fly   503 HLKKPGPSKVQVEITLLDTNDNTPKFEHGNLYEFKVPINAPTGYVIGQVVAHDPDEGPNGHLLYE 567
                   |...:.|.|||||||.|||. .:.|..::|.|||.|..:..|.|.|||.||.|.:.|.
Mouse   455 -------STADIVIQLLDTNDNVPKFT-SHYYIARIPENAPGGSNVVAVTAVDPDTGPWGKVHYS 511

  Fly   568 LQRPKGSGYIPFRLDNKNGTIYV---------GGPLRRGRIAVFVEATDQPTNPSERRFSLAVIT 623
            :.   |:|...|.:....|.||.         |    ..|...:|:|.|.     :.|:|||   
Mouse   512 IY---GTGSDLFLIHPSTGLIYTQPWASLDAEG----TSRYNFYVKAEDM-----DGRYSLA--- 561

  Fly   624 IEVYAT---IDDQAIDFVGAPYEFWVGANTPLGTSVGQVRTTLIYEGGDEIMYDLLHTYSEGV-P 684
             ||:.|   ::|....||.:..|..:...|||     ::..|.........:.|...|.:|.| .
Mouse   562 -EVFVTLLDVNDHYPQFVQSVQEKTMVLGTPL-----KIEATDQDAEEPNNLVDYSITRAEPVNV 620

  Fly   685 FAIEERSGIITVIRELSEFKRKVYQFEAVANYL----FANSSQSLVMSRSSSPLTTIA 738
            |.|:..:|.|       ..|..:...||:.|..    ::.|.|.....|.|...:|.|
Mouse   621 FDIDAHTGEI-------RLKNSIRSLEALHNITPSGDYSWSLQVQAKDRGSPSFSTTA 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637 33/123 (27%)
Cadherin_repeat 325..407 CDD:206637 19/88 (22%)
Cadherin_repeat 416..524 CDD:206637 32/116 (28%)
Cadherin_repeat 534..626 CDD:206637 30/100 (30%)
Cadherin_repeat 641..>714 CDD:206637 16/73 (22%)
CA 851..925 CDD:214520
CA 1026..1085 CDD:214520
Cadherin_repeat 1177..1280 CDD:206637
Cadherin_repeat 1289..1385 CDD:206637
Cadherin_repeat 1414..1510 CDD:206637
CA 1576..1658 CDD:214520
Cadherin_repeat 1666..1760 CDD:206637
Cdhr1NP_570948.1 Cadherin_repeat 42..130 CDD:206637 19/111 (17%)
Cadherin_repeat 139..242 CDD:206637 33/123 (27%)
Cadherin_repeat 251..350 CDD:206637 22/114 (19%)
Cadherin_repeat 364..469 CDD:206637 32/116 (28%)
Cadherin_repeat 478..573 CDD:206637 33/110 (30%)
Cadherin_repeat 580..679 CDD:206637 23/104 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 793..838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.