DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and cdh10

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:XP_002935630.3 Gene:cdh10 / 100496218 XenbaseID:XB-GENE-1012079 Length:787 Species:Xenopus tropicalis


Alignment Length:712 Identity:152/712 - (21%)
Similarity:250/712 - (35%) Gaps:262/712 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   850 GDANIKLRYIIANQQEVVNKISITEDGTLLTL---TG-------LDREQQPSYELTV-------- 896
            ||.::|  ||::....          |||..:   ||       :|||::..|.|..        
 Frog    84 GDESLK--YILSGDGA----------GTLFVIDEKTGDIHATRRIDREEKAFYTLRAQAVNRRTG 136

  Fly   897 -IVEYSTGLVSGAGIYQVNIKVDDVNDNAPKFNALTYVGLINENCVVGTELSMNHAILIQDADEG 960
             .||..:..|         ||:.|:|||.|.|....|...:.|...|||.:..   :...|||: 
 Frog   137 RPVEPESEFV---------IKIHDINDNEPTFLEEVYTASVPEMSDVGTYVVQ---VTAADADD- 188

  Fly   961 PNAEFRVQLQGDYSDEFSIEYVNGTSSENSTHHKMPSTTGAFNIFNLTDQWNDEFKYQELHTTFM 1025
            |:          |.:...:                        |:::                  
 Frog   189 PS----------YGNSAKV------------------------IYSI------------------ 201

  Fly  1026 QTNFKLSSGPYFRIS------YTGKRGLDREKQQLYNLKIIAAD----TGGLSGYAHLTVLVADV 1080
                 |...|||.:.      .|....::||.::.|.:.|.|.|    .|||||...:.:.::||
 Frog   202 -----LQGQPYFSVEPETGIIRTALPNMNRENREHYQVVIQAKDMGGQMGGLSGTTTVNITLSDV 261

  Fly  1081 NDNAPMFERISVFKDSRLEIREYTTDMEIYFVESSSGMTAPQATAAMMLAPPPYHIPGSPRFNVD 1145
            |||.|.|.:.|                                          |||         
 Frog   262 NDNPPRFSQNS------------------------------------------YHI--------- 275

  Fly  1146 RERSVGAGLGVVARAKSRRRMVRALTTKCPLFAIYEDTPVGTKVLQLSASDEDFGKNALLHYE-L 1209
                                            ::.|...||:.|.::.|:|.|.||||.:.|. |
 Frog   276 --------------------------------SVPETATVGSTVGRIKATDADIGKNAEVEYRIL 308

  Fly  1210 QGEQVERTPGMPMLRVHGVKYFAIDKLSGELSVNYPLSANIEIMLNLTV----TDID-------G 1263
            .|::.      .:..:...|    ....|.::|...|....:.:..|.|    |.:|       .
 Frog   309 DGDET------AVFNIFTEK----STQDGVITVRKRLDYESKRLYTLKVEAMNTHVDPHFYYLGP 363

  Fly  1264 LKDSTCLRFTVMDVNNHAPTFKKSWYSFDTPEGEYKDSVLGQLTAIDMDFGENANITYTLSDSHL 1328
            .||:..::.:|.|| :..|.|.:..|.|...|.....:::|.:.|.|.| ..::.:.::| |.|.
 Frog   364 FKDTCTVKISVEDV-DEPPVFSRPSYMFKVHEDIELGTIIGTVMARDPD-AISSPVRFSL-DRHT 425

  Fly  1329 P----FTIKPASGVLKIGGQLDRELKDKYSFQVIATD-NAPVMQRMSSSVDVEVNVLDINDNRPE 1388
            .    |.|...:|.:.....||||:...::..||||: |.|   :.::...|.:.:||||||.||
 Frog   426 DLDRIFHIYSGNGSIYTAKPLDREISQWHNLTVIATEINNP---KQATRATVFILILDINDNAPE 487

  Fly  1389 FIGYDDQTKAVKFIPSVADRTLMLPVYKAYLDRSTQPGTFVRQLTAIDKDNVGNGNGLV--LYSI 1451
            |..:                      |..::..:.:.|..::.::|:|||....|....  |.|:
 Frog   488 FAMF----------------------YDTFVCENARAGQLIQTISAVDKDEPPGGQKFFFSLASV 530

  Fly  1452 RHQEMQAPLFQI-DSRDGTISTISRINGYNDYEHLN---VSVIASDVGSPALSATAIVIVNL 1509
            .      |.|.: |:.|.|...::|.||:|.:| :|   :.|:.||...|..|:|..:.:.:
 Frog   531 N------PNFTVQDNEDNTARILTRRNGFNRHE-INTYLLPVVISDNDYPIQSSTGTLTIKV 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520 23/92 (25%)
CA 1026..1085 CDD:214520 21/68 (31%)
Cadherin_repeat 1177..1280 CDD:206637 27/114 (24%)
Cadherin_repeat 1289..1385 CDD:206637 28/100 (28%)
Cadherin_repeat 1414..1510 CDD:206637 26/102 (25%)
CA 1576..1658 CDD:214520
Cadherin_repeat 1666..1760 CDD:206637
cdh10XP_002935630.3 CA 79..157 CDD:214520 24/93 (26%)
Cadherin_repeat 163..264 CDD:206637 30/161 (19%)
Cadherin_repeat 272..379 CDD:206637 31/200 (16%)
Cadherin_repeat 387..484 CDD:206637 28/101 (28%)
Cadherin 492..586 CDD:394985 26/101 (26%)
Cadherin_C 634..781 CDD:395833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11590
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.