DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and cdh8

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:XP_002935098.2 Gene:cdh8 / 100486228 XenbaseID:XB-GENE-1002704 Length:810 Species:Xenopus tropicalis


Alignment Length:752 Identity:183/752 - (24%)
Similarity:284/752 - (37%) Gaps:244/752 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 SEPTSRNITMGSRFRSRNRSRSSKSKRR------------------LPRRLVGD---ANIKLRYI 859
            |...|.|.||.....|..:...::|||.                  |..||..|   .|.|::||
 Frog    46 SHTLSTNGTMELNGVSEEQKLLNRSKRGWVWNQMFVLEEFSGPEPILVGRLHTDLDPGNTKIKYI 110

  Fly   860 IANQQEVVNKISITED--GTLLTLTGLDREQQPSYELTV-IVEYSTG--LVSGAGIYQVNIKVDD 919
            ::.  |....|.:..|  |.:..:..||||::..|.||. .|:..|.  |...:   :..|||.|
 Frog   111 LSG--EGAGTIFVINDKTGDIHAMKRLDREEKAEYTLTAQAVDRDTNKPLEPPS---EFIIKVQD 170

  Fly   920 VNDNAPKFNALTYVGLINENCVVGTELSMNHAILIQDADE---GPNAEFRVQ-LQGDYSDEFSIE 980
            :|||||:|....|...:.|..:|||.::   .:...|||:   |.:|:.... |:|  ...||||
 Frog   171 INDNAPEFLNGPYHATVPEMSIVGTYVT---KLTATDADDPVYGNSAKLVYSILEG--QPYFSIE 230

  Fly   981 YVNGTSSENSTHHKMPSTTGAFNIFNLTDQWNDEFKYQELHTTFMQTNFKLSSGPYFRISYTGKR 1045
                                                                  |:..|..|...
 Frog   231 ------------------------------------------------------PHTAIIKTALS 241

  Fly  1046 GLDREKQQLYNLKIIAAD----TGGLSGYAHLTVLVADVNDNAPMFERISVFKDSRLEIREYTTD 1106
            .:|||.::.|.:.|.|.|    .|||||...:||.:.|||||.|.|                   
 Frog   242 NMDREAREEYLVVIQAKDMGGHMGGLSGTTTVTVTLTDVNDNPPKF------------------- 287

  Fly  1107 MEIYFVESSSGMTAPQATAAMMLAPPPYHIPGSPRFNVDRERSVGAGLGVVARAKSRRRMVRALT 1171
                                                                 |.|:.:      
 Frog   288 -----------------------------------------------------AMSQYQ------ 293

  Fly  1172 TKCPLFAIYEDTPVGTKVLQLSASDEDFGKNALLHYEL---QGEQV-------ERTPGMPMLRVH 1226
                 |.:.||..:|..|.::.|:|.|.|.||...:::   .|:.|       :...|:..||  
 Frog   294 -----FVVPEDVGIGDTVGRVKANDRDTGDNAKSSFDIIDGDGKDVFEMTTDPQTQDGLIRLR-- 351

  Fly  1227 GVKYFAIDKLSGELSVNYPL---SANIEIMLNLTVTDIDGL--KDSTCLRFTVMDVNNHAPTFKK 1286
                   ..|..|...:|.|   :||:    |:....|.|:  ||:..::.||.|. :..|.|..
 Frog   352 -------KPLDFESKKSYILKVEAANV----NIDPRFISGVPFKDTATVKITVEDA-DEPPVFSS 404

  Fly  1287 SWYSFDTPEGEYKDSVLGQLTAIDMDFGENANITYTLSDSHL----PFTIKPASGVLKIGGQLDR 1347
            ..|..:..|....:.|:||::|.|.| ...:.|.::: |.|.    .|.|....|.:.:..:|||
 Frog   405 PTYLLEVHENAVINGVIGQVSARDPD-SSASPIRFSI-DRHTDLDHQFNINADDGKITLAMELDR 467

  Fly  1348 ELKDKYSFQVIATDNAPVMQRMSSSVDVEVNVLDINDNRPEFIGYDDQTKAVKFIPSVADRTLML 1412
            |....::..|:||:.....|  .|.|.|.:.|||:|||.|||               ..|     
 Frog   468 ETNMWHNITVVATETRNHSQ--ISRVPVAIKVLDVNDNAPEF---------------ATD----- 510

  Fly  1413 PVYKAYLDRSTQPGTFVRQLTAIDKDNVGNGNGLVLYSIRHQEMQAPLFQI-DSRDGTISTISRI 1476
              |:|:|..:.:||..::.::|||||:..||: ..:||:.......|.|.| :::|.::|.::|.
 Frog   511 --YEAFLCENGKPGQIIQTVSAIDKDDPRNGH-FFIYSLLPDMANNPNFTIKNNQDNSLSVLARH 572

  Fly  1477 NGYN--DYEHLNVSVIASDVGSPALSATAIVIVNLQG 1511
            ||:|  ..|...:.:|.||.|:|.||:|:.:.:.:.|
 Frog   573 NGFNRLKQEVYFLPIIISDNGNPPLSSTSTLTIRVCG 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520 26/81 (32%)
CA 1026..1085 CDD:214520 22/62 (35%)
Cadherin_repeat 1177..1280 CDD:206637 30/117 (26%)
Cadherin_repeat 1289..1385 CDD:206637 29/99 (29%)
Cadherin_repeat 1414..1510 CDD:206637 32/98 (33%)
CA 1576..1658 CDD:214520
Cadherin_repeat 1666..1760 CDD:206637
cdh8XP_002935098.2 CA 98..176 CDD:214520 26/82 (32%)
Cadherin_repeat 182..>262 CDD:206637 26/138 (19%)
Cadherin_repeat 291..398 CDD:206637 30/131 (23%)
Cadherin_repeat 406..503 CDD:206637 29/100 (29%)
Cadherin_repeat 511..613 CDD:206637 33/100 (33%)
Cadherin_C 656..801 CDD:366437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11590
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.