DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-2 and DER1

DIOPT Version :9

Sequence 1:NP_650553.1 Gene:Der-2 / 42005 FlyBaseID:FBgn0038438 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_009760.1 Gene:DER1 / 852500 SGDID:S000000405 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:45/194 - (23%)
Similarity:87/194 - (44%) Gaps:4/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EIPVVTRAYTTVCVLTTLAVHLDLVSPLQLYFNPTLIVRKFQIWRLATTFLYFGTIGISFFFNMV 74
            :||:|||.:|..|::.:....|.:|.|.::.::..|:.:|.|..||..:...:|........|:.
Yeast    11 DIPLVTRLWTIGCLVLSGLTSLRIVDPGKVVYSYDLVFKKGQYGRLLYSIFDYGAFNWISMINIF 75

  Fly    75 FTYRYCRMLEDGSFRGRSSDFVMMFIFGGVLMTFFGIFVNLLFLGQAFTLMLVYVWSRRN-PLVP 138
            .:..:...||: ||..|.....::|:...:|:....|......||......|||...::| ..:.
Yeast    76 VSANHLSTLEN-SFNLRRKFCWIIFLLLVILVKMTSIEQPAASLGVLLHENLVYYELKKNGNQMN 139

  Fly   139 MNFFGVLNFQAPYLPWVLLCCSMILGNTVWVDV-IGMGVGHIYYVLEDVYPTLSNGYRLIKTPY 201
            :.|||.::......|..:......:....|::: :....||:.|.::|:...: .|..|.|:||
Yeast   140 VRFFGAIDVSPSIFPIYMNAVMYFVYKRSWLEIAMNFMPGHVIYYMDDIIGKI-YGIDLCKSPY 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-2NP_650553.1 DER1 11..201 CDD:282380 43/191 (23%)
DER1NP_009760.1 Rhomboid 12..>192 CDD:419717 40/180 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101672
Panther 1 1.100 - - LDO PTHR11009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.