DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-2 and DER1

DIOPT Version :9

Sequence 1:NP_650553.1 Gene:Der-2 / 42005 FlyBaseID:FBgn0038438 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_194662.2 Gene:DER1 / 829054 AraportID:AT4G29330 Length:266 Species:Arabidopsis thaliana


Alignment Length:208 Identity:74/208 - (35%)
Similarity:123/208 - (59%) Gaps:3/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNALRQFYLEIPVVTRAYTTVCVLTTLAVHLDLVSPLQLYFNPTLIVRKFQIWRLATTFLYFGTI 65
            |::..:||..:|.:|:||.|:|..||:|..|.||:|:.:...|.|::::||||||.|...:.|..
plant     1 MSSPGEFYNSLPPITKAYGTLCFFTTVATQLGLVAPVHIALIPELVLKQFQIWRLITNLFFLGGF 65

  Fly    66 GISFFFNMVFTYRYCRMLEDGSFRGRSSDFVMMFIFGGVLMTFFGI--FVNLLFLGQAFTLMLVY 128
            .|:|...::...||...||.|.|..|::||:.|.|||...:....:  |....|||.:...||:|
plant    66 SINFGIRLLMIARYGVQLEKGPFERRTADFLWMMIFGSFTLLVLSVIPFFWTPFLGVSLVFMLLY 130

  Fly   129 VWSRRNPLVPMNFFGVLNFQAPYLPWVLLCCSMILGNTVWVDVIGMGVGHIYYVLEDVYPTLSNG 193
            :|||..|...::.:|::..:|.||||.:|...:|.|:.:..|::|:..||:||.|..::| |:.|
plant   131 LWSREFPNANISLYGLVTLKAFYLPWAMLALDVIFGSPIMPDLLGIIAGHLYYFLTVLHP-LATG 194

  Fly   194 YRLIKTPYFLKRL 206
            ...:|||.::.::
plant   195 KNYLKTPKWVNKI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-2NP_650553.1 DER1 11..201 CDD:282380 70/191 (37%)
DER1NP_194662.2 Rhomboid 11..201 CDD:419717 69/190 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.