DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-2 and DERL1

DIOPT Version :9

Sequence 1:NP_650553.1 Gene:Der-2 / 42005 FlyBaseID:FBgn0038438 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_077271.1 Gene:DERL1 / 79139 HGNCID:28454 Length:251 Species:Homo sapiens


Alignment Length:247 Identity:79/247 - (31%)
Similarity:122/247 - (49%) Gaps:19/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNALRQFYLEIPVVTRAYTTVCVLTTLAVHLDLVSPLQLYFNPTLIVRKFQIWRLATTFLYF--- 62
            |:.:..::..||.:||.:....|...|...|.|:||..|:..|...:.:|||||..|...||   
Human     1 MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATFYFPVG 65

  Fly    63 -GTIGISFFFNMVFTYRYCRMLEDGSFRGRSSDFVMMFIFGGVLMTFFGIFVNLLFLGQAFTLML 126
             || |..:..|:.|.|:|...||.|:|.||.:|::.|.:|..:.:...|:.:::..|.....:.:
Human    66 PGT-GFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQLLMIPLIMSV 129

  Fly   127 VYVWSRRNPLVPMNFFGVLNFQAPYLPWVLLCCSMILGNTVWVDVIGMGVGHIYYVLEDVYPTLS 191
            :|||::.|..:.::|:....|:|.|||||:|..:.|:|.:|..::||..|||:|:.|...||...
Human   130 LYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDL 194

  Fly   192 NGYRLIKTPYFLKRLFNEHIERNFQAAAEDRPGGFPWGGEGQPLLPEEIAAD 243
            .|...:.||.||.|..            ..|.||.  .|.|.|......|||
Human   195 GGRNFLSTPQFLYRWL------------PSRRGGV--SGFGVPPASMRRAAD 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-2NP_650553.1 DER1 11..201 CDD:282380 65/193 (34%)
DERL1NP_077271.1 DER1 11..204 CDD:398288 65/193 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..251 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2482
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.