DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-2 and SPBC365.08c

DIOPT Version :9

Sequence 1:NP_650553.1 Gene:Der-2 / 42005 FlyBaseID:FBgn0038438 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_596037.1 Gene:SPBC365.08c / 2541072 PomBaseID:SPBC365.08c Length:224 Species:Schizosaccharomyces pombe


Alignment Length:198 Identity:57/198 - (28%)
Similarity:90/198 - (45%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRQFYLEIPVVTRAYTTVCVLTTLAVHLDLVSPLQLYFNPTLIVRKFQIWRLATTFLYFGTIGIS 68
            :::....||.|||........||:.....|:||..|..:..|:||:.|.:||.|.:||.|| |..
pombe     9 IQELLSRIPPVTRYILLGTAATTILTLCQLLSPSMLVLHYPLVVRQKQWYRLFTNYLYAGT-GFD 72

  Fly    69 FFFNMVFTYRYCRMLEDGSFRGRSSDFVMMFIFGGVLMTFFGIFVNL-LFLGQAFTLMLVYVWSR 132
            |..|:.|.|:|...||:..|...:..:::..:...:|:..|.:...| ..|.|:....:.|.||.
pombe    73 FIMNIYFFYQYSTYLENFVFARNAKKYIIYLVKVALLIDAFSLISGLGSALNQSLAAAIAYNWSL 137

  Fly   133 RNPLVPMNFFGVLNFQAPYLPWVLLCCSMILGNTVWVDVIGMGVGHIYYVLEDVYPTLSNGYRLI 197
            .|....:.|....:.|..|||:|||..|.:.|....:.|:|.|:         :...:.|.:..|
pombe   138 FNSFSKIQFLFGFHVQGKYLPYVLLGFSFLTGGLPSLVVLGFGI---------ISAMIVNFFDSI 193

  Fly   198 KTP 200
            .||
pombe   194 HTP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-2NP_650553.1 DER1 11..201 CDD:282380 57/191 (30%)
SPBC365.08cNP_596037.1 COG5291 1..224 CDD:227611 57/198 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 1 1.000 - - otm47051
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11009
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2482
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.910

Return to query results.
Submit another query.