DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Der-2 and cup-2

DIOPT Version :9

Sequence 1:NP_650553.1 Gene:Der-2 / 42005 FlyBaseID:FBgn0038438 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_492721.1 Gene:cup-2 / 172915 WormBaseID:WBGene00000843 Length:245 Species:Caenorhabditis elegans


Alignment Length:241 Identity:73/241 - (30%)
Similarity:115/241 - (47%) Gaps:10/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRQFYLEIPVVTRAYTTVCVLTTLAVHLDLVSPLQLYFNPTLIVRKFQIWRLATTFLYFGT---I 65
            |..|.|.||:|||.:.....:..|......::...::....|:|.|||.||..|..:|:..   .
 Worm     3 LENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYYPVTPQT 67

  Fly    66 GISFFFNMVFTYRYCRMLEDGSFRGRSSDFVMMFIFGGVLMTFFGIFVNLLFLGQAFTLMLVYVW 130
            |..:.....|.|.|.:.||..::||||:|::.|.||.....:...:.:::.||.:...:.::|||
 Worm    68 GFHWLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFLLEPMVISVLYVW 132

  Fly   131 SRRNPLVPMNFFGVLNFQAPYLPWVLLCCSMILGNTVWVDVIGMGVGHIYYVLEDVYPTLSNGYR 195
            .:.|....::|:..:.|.|.||||||...:.:|......:::|:.|||.|:.:...||. ..|..
 Worm   133 CQVNKDTIVSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGHAYFFVALKYPD-EYGVD 196

  Fly   196 LIKTPYFLKRLFNE-----HIERNFQAAAEDRPGGFPW-GGEGQPL 235
            ||.||.||.||..:     |.:......|..:|.|..| ||.|..|
 Worm   197 LISTPEFLHRLIPDEDGGIHGQDGNIRGARQQPRGHQWPGGVGARL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Der-2NP_650553.1 DER1 11..201 CDD:282380 56/192 (29%)
cup-2NP_492721.1 DER1 10..202 CDD:282380 56/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54051
OrthoDB 1 1.010 - - D1609512at2759
OrthoFinder 1 1.000 - - FOG0000789
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2482
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.