DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdhaf3 and SDH7

DIOPT Version :10

Sequence 1:NP_650552.3 Gene:Sdhaf3 / 42004 FlyBaseID:FBgn0038437 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_010799.3 Gene:SDH7 / 852123 SGDID:S000002919 Length:133 Species:Saccharomyces cerevisiae


Alignment Length:103 Identity:42/103 - (40%)
Similarity:54/103 - (52%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SQLTHPQRVRLLYKTILRLHRGLPAELRALGDNYVRDEFRRHLKC-NPMEAQLFMTEWARYASTI 70
            |||..|..|  ||:.|||.|:.||...|.:||.|||:||:.|... ||:....|:..|..|...|
Yeast    17 SQLLLPPLV--LYRRILRQHKLLPGPQREMGDQYVRNEFKLHKDIDNPLHIVGFLASWQDYLHMI 79

  Fly    71 TQQLGIRGKPKGELGEEIDPKTVEMLKDDQVVQLYELM 108
            :     .||.|   ...:..:|:|.|..:|.|||||||
Yeast    80 S-----NGKWK---DATLSSETLEKLSPEQTVQLYELM 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdhaf3NP_650552.3 Complex1_LYR_SDHAF3_LYRM10 15..70 CDD:380765 23/55 (42%)
SDH7NP_010799.3 Complex1_LYR_SDHAF3_LYRM10 23..79 CDD:380765 23/57 (40%)

Return to query results.
Submit another query.