DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdhaf3 and sdh7

DIOPT Version :10

Sequence 1:NP_650552.3 Gene:Sdhaf3 / 42004 FlyBaseID:FBgn0038437 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_595815.1 Gene:sdh7 / 2541309 PomBaseID:SPBP23A10.03C Length:115 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:47/111 - (42%)
Similarity:57/111 - (51%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LMSQ---LTHPQRVRLLYKTILRLHR-GLPAELRALGDNYVRDEFRRHLK-CNPMEAQLFMTEWA 64
            ||.|   ||.|..   ||:.:||.|| .|.||.|||||.||:.|||||.. .||:....|::.|.
pombe     7 LMKQKNILTPPLP---LYRRVLRAHRYHLGAEERALGDEYVKAEFRRHRNVTNPLHLVGFLSSWE 68

  Fly    65 RYASTITQQLGIRGKPKGELGEEIDPKTVEMLKDDQVVQLYELMLA 110
            |||..:..:     ..|.|.....|  .:|.|.|.|:.|||||..|
pombe    69 RYADALENE-----SWKQEKYSNTD--LLESLNDQQIGQLYELSKA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdhaf3NP_650552.3 Complex1_LYR_SDHAF3_LYRM10 15..70 CDD:380765 28/56 (50%)
sdh7NP_595815.1 Complex1_LYR_SDHAF3_LYRM10 17..74 CDD:380765 29/59 (49%)

Return to query results.
Submit another query.