DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhfr and thyA

DIOPT Version :10

Sequence 1:NP_732147.1 Gene:Dhfr / 42003 FlyBaseID:FBgn0004087 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_417304.1 Gene:thyA / 949035 ECOCYCID:EG11002 Length:264 Species:Escherichia coli


Alignment Length:89 Identity:19/89 - (21%)
Similarity:31/89 - (34%) Gaps:28/89 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PLPDRLNIVLSTTLQESDLPKGVLLCPNLETAMKILEEQNEVENIWIVGGSGVYEEAMASPRCH- 128
            |.||..:|...||:              |.......:.:..:.:.|.||..    :.||...|| 
E. coli   102 PTPDGRHIDQITTV--------------LNQLKNDPDSRRIIVSAWNVGEL----DKMALAPCHA 148

  Fly   129 --RLYIT------KIMQKFDCDTF 144
              :.|:.      ::.|: .||.|
E. coli   149 FFQFYVADGKLSCQLYQR-SCDVF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhfrNP_732147.1 DHFR 4..179 CDD:238127 19/89 (21%)
thyANP_417304.1 ThyA 1..264 CDD:439977 19/89 (21%)

Return to query results.
Submit another query.