DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhfr and AT5G65400

DIOPT Version :10

Sequence 1:NP_732147.1 Gene:Dhfr / 42003 FlyBaseID:FBgn0004087 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001331116.1 Gene:AT5G65400 / 836665 AraportID:AT5G65400 Length:270 Species:Arabidopsis thaliana


Alignment Length:52 Identity:12/52 - (23%)
Similarity:24/52 - (46%) Gaps:11/52 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PNLETAMKILEEQNEVENIWIVGGSGV----YEE------AMASP-RCHRLY 131
            |.::.....|.:..:|:.:.|:.|:.:    :.|      |.:|| ||..|:
plant   153 PGMQEQGSALTKVPKVKFLVIISGAKIPGLMFGEPKAAVNAFSSPVRCPSLH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DhfrNP_732147.1 DHFR 4..179 CDD:238127 12/52 (23%)
AT5G65400NP_001331116.1 FSH1 46..241 CDD:461110 12/52 (23%)

Return to query results.
Submit another query.