DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy7

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_445848.1 Gene:Adcy7 / 84420 RGDID:619966 Length:1100 Species:Rattus norvegicus


Alignment Length:270 Identity:79/270 - (29%)
Similarity:143/270 - (52%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 LSRELVMAGWQHCSKLEIM----FEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERM- 479
            |||::     .:..:|:.:    |:||.:..:.:|....|          ||.:::|..:|... 
  Rat   833 LSRQI-----DYYCRLDCLWKKKFKKEHEEFETMENVNRL----------LLENVLPAHVAAHFI 882

  Fly   480 --RKSEEHVCQSFEEVSVIFIEV--MNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FV 537
              :.:|:...||::.|.|:|..|  ..::.:..:..::.::.:..||::.:..||.::.|   .|
  Rat   883 GDKAAEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGLECLRLLNEIIADFDELLLKPKFSGV 947

  Fly   538 YKVETVGMVYMAVSG-----APDVNPLHAEHA-----CDLALRVMKK---VKAHALPGVAIRVGI 589
            .|::|:|..|||.:|     ..:...|..:|.     .:.::.:|.|   :..|:.....:||||
  Rat   948 EKIKTIGSTYMAAAGLSVPSGHENQDLERKHVHIGVLVEFSMALMSKLDGINRHSFNSFRLRVGI 1012

  Fly   590 NSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK 654
            |.|||:|||:|.:.|:|.::|:|||.||||||:.:...||::..|...:|.:||..|.||.:.||
  Rat  1013 NHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCECRGLINVK 1077

  Fly   655 GKGEMETYWL 664
            ||||:.||::
  Rat  1078 GKGELRTYFV 1087

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 13/62 (21%)
Nucleotidyl_cyc_III 488..665 CDD:416391 65/195 (33%)
Adcy7NP_445848.1 AC_N <21..251 CDD:318454
Guanylate_cyc 272..422 CDD:306677
DUF1053 487..593 CDD:399378
Guanylate_cyc 891..1087 CDD:306677 65/195 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.