DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and si:dkey-37g12.1

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_021333677.1 Gene:si:dkey-37g12.1 / 796669 ZFINID:ZDB-GENE-090312-145 Length:882 Species:Danio rerio


Alignment Length:296 Identity:99/296 - (33%)
Similarity:166/296 - (56%) Gaps:30/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 IKDVDSLIFLC---SPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRS 446
            :::::||:..|   :| .|..|..: |...:...:|||:|..:          |:.:..:.||.:
Zfish   598 VEELESLVVSCWRETP-AERPDFSY-IRTAIKKNSPHGVSENI----------LDDLLSRMEQYA 650

  Fly   447 DEL-----EKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEVMNIYDS 506
            ..|     |::.||.:. |::.:.||..|:||.:|.::...:....::::.|::.|.::.. :.:
Zfish   651 CNLEEIVSERTAELQEE-KKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVTIYFSDIEG-FTA 713

  Fly   507 GSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN-PLHAEHACDLALR 570
            .|.:: ..||.|..||.:::..|..|....||||||:|..||.|||.|..| ..||:....::|.
Zfish   714 MSASL-TPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDHAKEIARMSLA 777

  Fly   571 VMKKVKAHALPGV-----AIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQL 630
            :::.:::...|.|     .:|:|::|||.||||||:|:||||||||||||||||||...|..|.:
Zfish   778 IVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRMESYGLPLKIHV 842

  Fly   631 SNYTALKVQKV-GYKVEARGFVKVKGKGEMETYWLL 665
            |:.|...:... .::.|.||.:.:||||.:.|:|||
Zfish   843 SSSTKSLLDTFRNFRCELRGDIHIKGKGWVRTFWLL 878

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 25/101 (25%)
Nucleotidyl_cyc_III 488..665 CDD:416391 72/183 (39%)
si:dkey-37g12.1XP_021333677.1 Periplasmic_Binding_Protein_Type_1 <59..258 CDD:324556
PKc_like 355..628 CDD:328722 7/31 (23%)
HNOBA <641..687 CDD:311573 13/46 (28%)
CYCc 666..850 CDD:214485 70/186 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.