DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Gucy1a2

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_076446.1 Gene:Gucy1a2 / 66012 RGDID:621655 Length:730 Species:Rattus norvegicus


Alignment Length:600 Identity:145/600 - (24%)
Similarity:267/600 - (44%) Gaps:131/600 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPK---MKSPSMQLTNMD 125
            |...||..||..      .::::|:.|....||....|.:...:|.::.|   ::|||.....:.
  Rat   171 FGEEFFKICFDE------NERVLRAVGSTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELP 229

  Fly   126 DDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGP-------IKLTE 183
            :....:.|......:...::|.:....|..|.|::....:|::. .|...:.|       ..:.|
  Rat   230 EGTLKLHYFHPHHTVGFAMLGMIKAAGKRIYHLNVEVEQIENEK-FCSDGSTPSNYSCLTFLIKE 293

  Fly   184 GPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPS---VDLNVFLELFPFTIVLDHDMKITLAG 245
            ...|.|.|               |:....||:  |:   :.:|.|...|||.::.|.:|.:...|
  Rat   294 CETTQITK---------------NIPQGTSQI--PTDLRISINTFCRTFPFHLMFDPNMVVLQLG 341

  Fly   246 EKIVETWILHNPGVNPKTFIGSHILERFK-CRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAA 309
            |           |:..:....:|.:.:|: |                      ||::....| |.
  Rat   342 E-----------GLRKQLRCDNHKVLKFEDC----------------------FEIVSPKVN-AT 372

  Fly   310 YDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEIDPATGQRRHSVGLR 374
            :|..|                    |..:..|......|  |:...::|::              
  Rat   373 FDRVL--------------------LRLSTPFVIRTKPE--ASGTDNEDKV-------------- 401

  Fly   375 SILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMF 439
             :.:||||.::.:.::::||.||.::.||||.|.||:|:|:..|..:|::::.|.|  :|.:...
  Rat   402 -MEIKGQMIHVPESNAILFLGSPCVDKLDELIGRGLHLSDIPIHDATRDVILVGEQ--AKAQDGL 463

  Fly   440 EKEEQRSDE----LEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEV 500
            :|   |.|:    |||:.:..:..|::..:||||:.|..:|:::.:.::...:.|::|:::|.::
  Rat   464 KK---RMDKLKATLEKTHQALEEEKKKTVDLLYSIFPGDVAQQLWQRQQVQARKFDDVTMLFSDI 525

  Fly   501 MNIYDSGSNNI---QDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNPLHAE 562
            :     |...|   ...||.::.||::::..|.:.....:|||||:|..|...||....:..||:
  Rat   526 V-----GFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVASGLHRKSLCHAK 585

  Fly   563 HACDLALRVMKKVKAHALPG---VAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSD 624
            ....:||::|:..:....|.   :.:|:||:||.|:|||||:::|||||||:.|..||:.||.|.
  Rat   586 PIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSH 650

  Fly   625 PWMIQLS--NYTALK 637
            |..|.:|  .|..||
  Rat   651 PRRINISPTTYQLLK 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167 20/99 (20%)
HNOBA 218..479 CDD:400168 60/268 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 54/157 (34%)
Gucy1a2NP_076446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
HNOB <157..268 CDD:285002 20/102 (20%)
HNOBA 314..501 CDD:285003 58/262 (22%)
CYCc 483..672 CDD:214485 61/187 (33%)
Guanylate_cyc 512..696 CDD:278633 54/158 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D245586at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.