DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy3

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_570135.2 Gene:Adcy3 / 64508 RGDID:71009 Length:1144 Species:Rattus norvegicus


Alignment Length:316 Identity:90/316 - (28%)
Similarity:151/316 - (47%) Gaps:53/316 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 SPLI--ENLDELHGIGLYLND----LNPHGLSRELVMAGW--------QHCSKL-EIMFEKEEQR 445
            ||::  |.:..|...||...|    |.|...|..::|...        :|..|| ..:|..:.:.
  Rat   810 SPMVALEKMQVLSTPGLNGTDSRLPLVPSKYSMTVMMFVMMLSFYYFSRHVEKLARTLFLWKIEV 874

  Fly   446 SDELEKSLELADSWKRQGDELLYSMIPRPIAERM----RKSEEHVCQSFEEVSVIFIEVMNIYD- 505
            .|:.|:..|:    :|..:.|:.:|:|..:|...    ::.||...||::|:.|:|..:.|..| 
  Rat   875 HDQKERVYEM----RRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADF 935

  Fly   506 ---SGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKVETVGMVYMAVSG-APDVNP----- 558
               ...||  ..::.:..||::.|..|..:.:|   .:.|::|:|..|||.|| .||||.     
  Rat   936 YTEESINN--GGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTS 998

  Fly   559 ------------LHAEHACDLALRV---MKKVKAHALPGVAIRVGINSGPVVAGVVGMKVPRYCL 608
                        .|.....|.||.:   :..:...:.....:|:|:|.|.|:|||:|.:.|.|.:
  Rat   999 SSKEEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDI 1063

  Fly   609 FGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWL 664
            :|:|||.||||||:.....||:...|.:.:::.|::...||.:.||||||:.|::|
  Rat  1064 WGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFL 1119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 23/97 (24%)
Nucleotidyl_cyc_III 488..665 CDD:416391 65/205 (32%)
Adcy3NP_570135.2 AC_N <44..303 CDD:318454
Guanylate_cyc 310..494 CDD:306677
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..563
Guanylate_cyc 914..1121 CDD:306677 65/208 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.