DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and adcy7

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_021333246.1 Gene:adcy7 / 568726 ZFINID:ZDB-GENE-040713-1 Length:1119 Species:Danio rerio


Alignment Length:325 Identity:91/325 - (28%)
Similarity:157/325 - (48%) Gaps:65/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 ENLDELHGIGLYLNDLNPHGLSRELVM--AGWQHCSKL------------EIMFEKEEQ---RSD 447
            |||...:...||.|    |.....|::  ||.....|:            .::..::.:   |.|
Zfish   787 ENLFSNYNCLLYTN----HSCGDSLMVCKAGLMKHPKIMSCIYITLFLFTMLLISRQNEYCCRQD 847

  Fly   448 ELEKSLELADSWKRQGDE-----LLYSMIPRPIAERM-------------------RKSEEHVCQ 488
            .|.|:..|||..:.:..|     ||.:::|..:|...                   ||.::...:
Zfish   848 FLLKNKNLADKEEVELCENLNRLLLENVLPAHVAALFVGENKKNEVGLLSAISLLNRKYKDLYYK 912

  Fly   489 SFEEVSVIFIEV---MNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKVETVGMVY 547
            |::.|.|:|..|   ...|.....| ::.::.:..||::.:..||.:..|   .|.|::|:|..|
Zfish   913 SYDCVCVMFASVPDFKEFYTECDIN-KEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTY 976

  Fly   548 MA---VSGAPDVNPLHAE-------HACDLALRVMKK---VKAHALPGVAIRVGINSGPVVAGVV 599
            ||   :||.|:.:....|       :..:.|:.::.|   :..|:.....:|||||.|||:|||:
Zfish   977 MAAAGLSGPPEQSNQDRERQNAQIGNMVEFAIALIGKLDGINRHSFNTFRLRVGINHGPVIAGVI 1041

  Fly   600 GMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWL 664
            |.:.|:|.::|:|||.||||||:.:...||::..|::.:|.:||..|.||.:.||||||::|:::
Zfish  1042 GARKPQYDIWGNTVNVASRMESTGELGKIQVTEETSIVLQNLGYSCECRGLINVKGKGELKTFFV 1106

  Fly   665  664
            Zfish  1107  1106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 23/100 (23%)
Nucleotidyl_cyc_III 488..665 CDD:416391 66/196 (34%)
adcy7XP_021333246.1 AC_N <129..248 CDD:318454
Guanylate_cyc 272..455 CDD:306677
DUF1053 487..613 CDD:310728
Guanylate_cyc 909..1106 CDD:306677 66/197 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.