DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and adcy2a

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_692173.5 Gene:adcy2a / 563724 ZFINID:ZDB-GENE-061109-1 Length:1155 Species:Danio rerio


Alignment Length:291 Identity:80/291 - (27%)
Similarity:152/291 - (52%) Gaps:36/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 LIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQ 462
            ::::|..:..:.|::..:....|:|:.     ::..:|:.:::      ::.:|..|..::.:..
Zfish   862 VLKDLKTMGSVSLFIFFITLLVLARQN-----EYYCRLDFLWK------NKFKKECEEIETMENL 915

  Fly   463 GDELLYSMIPRPIAE----RMRKSEEHVCQSFEEVSVIFIEV---MNIYDSGSNNIQDAMQAVTT 520
            ...||.:::|..:||    |..|:|:...||::.|.|:|..:   ...|.....| ::.::.:..
Zfish   916 NRVLLENVLPAHVAEHFLARNWKNEDLYHQSYDLVCVMFASIPDFKEFYTESDVN-KEGLECLRL 979

  Fly   521 LNKVFSALDEEIISP---FVYKVETVGMVYMAVSG-----AP------DVNPLHAEHACDLALRV 571
            ||::.:..||.:..|   .|.|::|:|..|||.:|     .|      |...:|.....:.|..:
Zfish   980 LNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATPGPEYTQEHDRQYMHIGTMVEFAFAL 1044

  Fly   572 MKK---VKAHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNY 633
            :.|   :..|:.....:|||||.|||.|||:|.:.|:|.::|:|||.||||:|:.....||::..
Zfish  1045 VGKLDVINKHSFNDFKLRVGINHGPVKAGVIGAQKPQYDIWGNTVNVASRMDSTGVLGKIQVTEE 1109

  Fly   634 TALKVQKVGYKVEARGFVKVKGKGEMETYWL 664
            |:..:|.:||....||.:.||||||::||::
Zfish  1110 TSCILQTLGYTCSCRGIINVKGKGELKTYFV 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 12/84 (14%)
Nucleotidyl_cyc_III 488..665 CDD:416391 65/197 (33%)
adcy2aXP_692173.5 AC_N <92..319 CDD:292831
CYCc 295..498 CDD:214485
Guanylate_cyc 340..524 CDD:278633
DUF1053 554..658 CDD:283888
CYCc 912..1120 CDD:214485 62/208 (30%)
Guanylate_cyc 942..1141 CDD:278633 65/200 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.