DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and si:dkey-206f10.1

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_009293230.1 Gene:si:dkey-206f10.1 / 560719 ZFINID:ZDB-GENE-041014-154 Length:1187 Species:Danio rerio


Alignment Length:464 Identity:118/464 - (25%)
Similarity:207/464 - (44%) Gaps:108/464 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 HNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAYDAALNFDFE 319
            |:|||          |::|.|...::..::  .:|.:..:                  |:||...
Zfish   717 HSPGV----------LQQFCCWIHENNSMR--NLLTITAI------------------AMNFGMA 751

  Fly   320 NFD----EASSLNEAQAMALASAKEFSAENAKEEAAAAATSKD--EIDPATGQRRHSVGLR-SIL 377
            .||    .:|.:.|      .|.:|.....|.::...|.|..:  .:.........:|.|| |.|
Zfish   752 LFDMMWCNSSEMKE------ISTRETEGYKAGQKPLTACTYPEVFVLSGVVSMVTCAVFLRMSSL 810

  Fly   378 LKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRE----------LVMA----- 427
            ||        :..|:|:.: :.....|:....||::......|||.          |:||     
Zfish   811 LK--------LTILLFVVA-VYTYFIEVSFHMLYVHQQEHEHLSRSHFLRRKGVSILLMAMFMIA 866

  Fly   428 ------GWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDE-LLYSMIPRPIA----ERMRK 481
                  .|:..::|:.::..:.|:  |:::..:|     |:.:| ||::::|..:|    ||.|.
Zfish   867 VLYNGRRWEATTRLDFLWRLQAQQ--EVQEMRDL-----REHNECLLHNILPAHVARHFLERNRN 924

  Fly   482 SEEHVCQSFEEVSVIFIEV--MNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPF---VYKVE 541
            .:|...||::||.|:|..:  .|.|........:.::.:..||::.:..||.:...:   :.|::
Zfish   925 DQELYSQSYDEVGVMFASIAGFNDYYEQKEIKHEGVECLKLLNEIIADFDELLEESYFLDIEKIK 989

  Fly   542 TVGMVYMAVSG-APD-----VNPLHAEHACDLAL------RVMKKVKAHALPGVAIRVGINSGPV 594
            |:|..|||.|| :||     ||..|  |..:|.|      ..::::..|::....:||||..|||
Zfish   990 TIGSCYMAASGLSPDKQSRVVNDWH--HLSELVLFALAMQETLREINKHSMNNFQLRVGIAHGPV 1052

  Fly   595 VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKG---- 655
            ||||:|...|:|.::|.|||.||||:|:.....||:...|...:...|:.:|.||.:.:||    
Zfish  1053 VAGVIGATKPQYDIWGMTVNLASRMDSTGVSGRIQVPEATRNILADWGFVLELRGEIYIKGVSER 1117

  Fly   656 KGEMETYWL 664
            ||.:.||::
Zfish  1118 KGRVRTYFI 1126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 50/256 (20%)
Nucleotidyl_cyc_III 488..665 CDD:416391 65/198 (33%)
si:dkey-206f10.1XP_009293230.1 AC_N <135..380 CDD:292831
CYCc 343..538 CDD:214485
Guanylate_cyc 382..564 CDD:278633
DUF1053 <611..661 CDD:283888
CYCc 899..1097 CDD:214485 65/199 (33%)
Guanylate_cyc 928..1126 CDD:278633 65/199 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.