DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and si:ch211-132f19.7

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_688903.4 Gene:si:ch211-132f19.7 / 560410 ZFINID:ZDB-GENE-130530-619 Length:1183 Species:Danio rerio


Alignment Length:267 Identity:82/267 - (30%)
Similarity:139/267 - (52%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDE-LLYSMIPRPIA----ERMR 480
            ||:|     :..|:|:.::..  |...|:|...||     |:.:| |||:::|..:|    ||.|
Zfish   875 SRQL-----ETTSRLDFLWRL--QARQEVEDMKEL-----REHNECLLYNILPAHVARHFLERDR 927

  Fly   481 KSEEHVCQSFEEVSVIFIEV--MNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPF---VYKV 540
            .:|:...:|:|.|.|:|..:  .:.|......|...::.:..||::.:..||.:..|:   :.|:
Zfish   928 NNEDLFSESYERVGVMFASIPGFSDYYEKKELIHQDVECLRLLNEIIADFDELLDEPYFQDIEKI 992

  Fly   541 ETVGMVYMAVSG-APDVNPLHAE--HACDLAL------RVMKKVKAHALPGVAIRVGINSGPVVA 596
            :|:|..|||.|| :|:......|  |...|.|      ..:|::.........:||||:.|||||
Zfish   993 KTIGSCYMAASGLSPEKQECEDEWAHLSTLVLFALAMQETLKEINKRTSNDFWLRVGISHGPVVA 1057

  Fly   597 GVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKG----KG 657
            ||:|...|:|.::|.|||.||||:|:.....||:...|:..:.:.|:.::.||.:.|||    :|
Zfish  1058 GVIGATKPQYDIWGMTVNLASRMDSTGLSGRIQVPEATSRVLAEHGFMLQLRGEIYVKGVSERRG 1122

  Fly   658 EMETYWL 664
            .:.||::
Zfish  1123 AVRTYFV 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 18/62 (29%)
Nucleotidyl_cyc_III 488..665 CDD:416391 61/195 (31%)
si:ch211-132f19.7XP_688903.4 AC_N <133..375 CDD:292831
CYCc 338..537 CDD:214485
Guanylate_cyc 381..559 CDD:278633
DUF1053 579..667 CDD:283888
CYCc 903..1103 CDD:214485 63/199 (32%)
Guanylate_cyc 932..1131 CDD:278633 61/198 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.