DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy4

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_062158.2 Gene:Adcy4 / 54223 RGDID:2034 Length:1072 Species:Rattus norvegicus


Alignment Length:263 Identity:82/263 - (31%)
Similarity:143/263 - (54%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 QHCSKLEIMFEK----EEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERM----RKSEEHV 486
            ::..:|:.:::|    |.:.::.:|....|          ||.:::|..:|.:.    |::|:..
  Rat   808 EYYCRLDFLWKKKLRQEREETETMENLTRL----------LLENVLPAHVAPQFIGQNRRNEDLY 862

  Fly   487 CQSFEEVSVIFIEVMNI--YDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKVETVGMV 546
            .||:|.|.|:|..:.:.  :.|.||...:.::.:..||::.:..||.:..|   .|.|::|:|..
  Rat   863 HQSYECVCVLFASIPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGST 927

  Fly   547 YMAVSGAPDVNP-----LHAEHAC-------DLALRVMKK---VKAHALPGVAIRVGINSGPVVA 596
            |||.:|. :..|     ..||.:|       :.|:.:..|   :..|:.....:|||:|.|||||
  Rat   928 YMAATGL-NATPGQDTQQDAERSCSHLGTMVEFAVALGSKLGVINKHSFNNFRLRVGLNHGPVVA 991

  Fly   597 GVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMET 661
            ||:|.:.|:|.::|:|||.||||||:.....||::..||..:|.:||...:||.:||||||::.|
  Rat   992 GVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSLGYTCYSRGVIKVKGKGQLCT 1056

  Fly   662 YWL 664
            |:|
  Rat  1057 YFL 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 9/52 (17%)
Nucleotidyl_cyc_III 488..665 CDD:416391 71/197 (36%)
Adcy4NP_062158.2 AC_N <115..246 CDD:292831
CYCc 219..422 CDD:214485
Guanylate_cyc 264..430 CDD:278633
DUF1053 479..580 CDD:283888
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..523
CYCc 824..1039 CDD:214485 68/225 (30%)
Guanylate_cyc 861..1060 CDD:278633 71/200 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.