DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy1

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_033752.1 Gene:Adcy1 / 432530 MGIID:99677 Length:1118 Species:Mus musculus


Alignment Length:250 Identity:79/250 - (31%)
Similarity:129/250 - (51%) Gaps:33/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 EKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSE----EHVCQSFEEVSVIFIEV 500
            :.||:| |::|:.       |.....:|::::|..:|:....|.    :...||:.:|.|:|..:
Mouse   817 QAEEER-DDMERV-------KLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASI 873

  Fly   501 MNIYD----SGSNNIQDAMQAVTTLNKVFSALDEEIISPF---VYKVETVGMVYMAVSGAPDVNP 558
            .|..|    ...||:  .::.:..||::.:..||.:...|   :.|::|:|..|||..|......
Mouse   874 PNFNDFYIELDGNNM--GVECLRLLNEIIADFDELMDKDFYKDLEKIKTIGSTYMAAVGLAPTAG 936

  Fly   559 LHAE-----HACDLA------LRVMKKVKAHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDT 612
            ..|:     |.|.||      ..|:.::...:.....:|||||.|||||||:|.:.|:|.::|:|
Mouse   937 TRAKKSISSHLCTLADFAIDMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNT 1001

  Fly   613 VNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWLLEG 667
            ||.||||:|:.....||::......:::..|:...||.|.|||||||.||: |||
Mouse  1002 VNVASRMDSTGVQGRIQVTEEVHRLLKRCSYQFVCRGKVSVKGKGEMLTYF-LEG 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 9/38 (24%)
Nucleotidyl_cyc_III 488..665 CDD:416391 66/194 (34%)
Adcy1NP_033752.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
AC_N <158..291 CDD:292831
CYCc 257..452 CDD:214485
Guanylate_cyc 293..475 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 492..519
CYCc 825..1036 CDD:214485 60/219 (27%)
Guanylate_cyc 858..1055 CDD:278633 67/199 (34%)
Interaction with calmodulin. /evidence=ECO:0000250 1023..1046 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1079..1118
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.