DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and CG43373

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001097622.2 Gene:CG43373 / 39835 FlyBaseID:FBgn0263131 Length:1854 Species:Drosophila melanogaster


Alignment Length:284 Identity:83/284 - (29%)
Similarity:136/284 - (47%) Gaps:44/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 NPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDE--------------L 466
            |...|.|.::.:.:.....|.::|     .|.:.|.:..|...||.|..|              |
  Fly  1203 NEEALLRYIIDSIFLFAFMLALIF-----HSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKL 1262

  Fly   467 LYSMIPRPIAERMRKSEEHVCQSFEE----VSVIFIEVMNIYD-----SGSNNIQDAMQAVTTLN 522
            |.:::|..:||.....|:|:...:.|    |.::|..:.|..:     .|:|   :.::.:..||
  Fly  1263 LENILPVHVAEHFLSREKHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNN---EGVECLRLLN 1324

  Fly   523 KVFSALDEEIISP----FVYKVETVGMVYMAVSG-----APDVNPLHAEHACDLALRVMKK---V 575
            ::.:..| |::|.    .:.|:::.|..|||.||     ...||..|.....|.||::..|   |
  Fly  1325 EIIADFD-ELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEV 1388

  Fly   576 KAHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQK 640
            ..|:.....:|:|||.|||||||:|...|:|.::|:.||.||||:|:.....||::......::.
  Fly  1389 NMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQEMQQILEG 1453

  Fly   641 VGYKVEARGFVKVKGKGEMETYWL 664
            .|:::..||.|.|||||.|.||:|
  Fly  1454 RGFELTCRGSVDVKGKGSMITYFL 1477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 17/76 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 64/198 (32%)
CG43373NP_001097622.2 AC_N <523..720 CDD:292831
CYCc 686..881 CDD:214485
Guanylate_cyc 722..895 CDD:278633
DUF1053 <949..1005 CDD:283888
CYCc 1259..1455 CDD:214485 58/199 (29%)
Guanylate_cyc 1285..1479 CDD:278633 64/197 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.