DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and CG10738

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:243 Identity:91/243 - (37%)
Similarity:142/243 - (58%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 QHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVS 494
            ::.:.||.:.   :.|:|:|::.       |::.|.||:.|:||.:|::::|..:...:.:|:||
  Fly   868 KYANNLEALV---DDRTDQLQEE-------KKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVS 922

  Fly   495 VIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN-P 558
            :.|.:::..  :..:.....:|.|..||.:::..|..|....||||||:|..||.|||.|..| .
  Fly   923 IYFSDIVGF--TAMSAECTPLQVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGD 985

  Fly   559 LHAEHACDLALRVMK-----KVKAHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASR 618
            |||.....::|.::.     |::......:.:|:||:||||.|||||:|:|||||||||||||||
  Fly   986 LHAAEIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASR 1050

  Fly   619 MESSSDPWMIQLSNYTALKVQKV-GYKVEARGFVKVKGKGEMETYWLL 665
            ||||..|..|..|......:.:: ||....||.:.:||||:..|||||
  Fly  1051 MESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLL 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 13/48 (27%)
Nucleotidyl_cyc_III 488..665 CDD:416391 75/183 (41%)
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 13/48 (27%)
CYCc 886..1078 CDD:214485 75/200 (38%)
Guanylate_cyc 913..1099 CDD:278633 77/188 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.