DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and ACXD

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_620469.2 Gene:ACXD / 38284 FlyBaseID:FBgn0040507 Length:1162 Species:Drosophila melanogaster


Alignment Length:318 Identity:78/318 - (24%)
Similarity:138/318 - (43%) Gaps:84/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 LKGQMFYIKDVDSLIFLCSPLIENLDELHGIGL-YLND--------LNPHGLS---RELVMAGWQ 430
            |:.:::| ::.|::..:.:. |:|.| ...||| .||:        ||.:..|   .::.:|.|.
  Fly   874 LQNELYY-EEYDNVAVMFAS-IKNFD-TDKIGLRVLNEIICDFDDVLNKYSQSLRVEKIKVANWT 935

  Fly   431 HCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSV 495
            :.:...:...:.||.:                             |.:|:         |..||:
  Fly   936 YMAACGLDVSRSEQVN-----------------------------APQMK---------FRNVSL 962

  Fly   496 IFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNPLH 560
            :.....:.||...::..|.:|.|...|....|||.::     .:.:..|.|   ::..|.::..|
  Fly   963 MPNGRRSRYDGARSSNADGVQRVPYGNGSNIALDLDL-----ERGQYEGNV---ITSGPRISSTH 1019

  Fly   561 ------------AEHACDLALRVMKKVKAHALP---------GVAIRVGINSGPVVAGVVGMKVP 604
                        ||.|.|| :|.|::.....:.         |: :|:||:.|..:|||||:..|
  Fly  1020 NGSSSNEVVRVMAEFALDL-MRTMRRFNTENMQTEYEGSTDYGM-LRIGISHGRAMAGVVGISKP 1082

  Fly   605 RYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETY 662
            .|.::|:.||.||||:|:..|..||::..||||:::...:...||...|||:|.:.||
  Fly  1083 HYDIWGNPVNMASRMDSTGVPGQIQVTENTALKLREFNIQCNYRGMTFVKGRGNIPTY 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 19/112 (17%)
Nucleotidyl_cyc_III 488..665 CDD:416391 58/196 (30%)
ACXDNP_620469.2 AC_N <42..284 CDD:292831
CYCc 254..476 CDD:214485
Nucleotidyl_cyc_III 321..503 CDD:299850
CYCc 856..1117 CDD:214485 70/293 (24%)
Nucleotidyl_cyc_III 878..1142 CDD:299850 77/314 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453997
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.