DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and CG3216

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_726013.2 Gene:CG3216 / 37376 FlyBaseID:FBgn0034568 Length:1161 Species:Drosophila melanogaster


Alignment Length:257 Identity:96/257 - (37%)
Similarity:147/257 - (57%) Gaps:26/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 VMAGWQHCSKL-EIMFEKEEQRSDELEK---------SLELADSWKRQGDELLYSMIPRPIAERM 479
            :|.|:  |..| :.:..:.||.::.||.         |||     |::.:||||.::|||:|:::
  Fly   882 IMKGF--CENLMDDLLNRMEQYANNLESLVEEKTRQLSLE-----KQRTEELLYQILPRPVAQQL 939

  Fly   480 RKSEEHVCQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVG 544
            ...:....:.|..|::.|.:::...:..:.:  ..|..|..||.::|..|..|....||||||:|
  Fly   940 MAGDLVEPEEFSSVTIYFSDIVGFTELCARS--SPMDVVNFLNDLYSTFDRIIGFYDVYKVETIG 1002

  Fly   545 MVYMAVSGAPDVN-PLHAEHACDLALRVMKKVKAHALP-----GVAIRVGINSGPVVAGVVGMKV 603
            ..|:.|||.|:.| ..||.....:||.:::.|.:..|.     .:.||:|::||.|.|||||.|:
  Fly  1003 DAYLVVSGLPEPNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKM 1067

  Fly   604 PRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVG-YKVEARGFVKVKGKGEMETYWL 664
            |.||||||||||||||||:..|..|.:|:.|...:.|.| :::|.||.|::||||.:.||||
  Fly  1068 PHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWL 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 20/63 (32%)
Nucleotidyl_cyc_III 488..665 CDD:416391 76/184 (41%)
CG3216NP_726013.2 PBP1_NPR_like 90..496 CDD:107368
ANF_receptor 107..479 CDD:279440
PKc_like 616..885 CDD:304357 1/2 (50%)
TyrKc 627..877 CDD:197581
HNOBA <882..939 CDD:285003 20/63 (32%)
CYCc 918..1109 CDD:214485 75/197 (38%)
Guanylate_cyc 945..1131 CDD:278633 76/187 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.