DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Ac13E

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster


Alignment Length:217 Identity:65/217 - (29%)
Similarity:112/217 - (51%) Gaps:19/217 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 KRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKV 524
            |.|.|.||:::||:.:||.::.:.:: .::...:::||..::|..:....:.....:.:..||::
  Fly  1363 KNQADMLLHNIIPKHVAEHLKNTAKY-SENHHNIAIIFASIVNFNEMYDESYLGGKEFLRVLNEL 1426

  Fly   525 FSALDEEIISP---FVYKVETVGMVYMAVSGAPDVNPLHA----EH---ACDLALRVMKKVKAHA 579
            ....||.:..|   .|.|::|:|..:||.||   ::|.|.    ||   ..:.::.:.:.|.|..
  Fly  1427 IGDFDELLSRPEFRAVEKIKTIGSTFMAASG---LDPSHRGTGDEHIHTLMEFSIAMQEVVDAFN 1488

  Fly   580 LP----GVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQK 640
            ..    .:.:|:|:|.|.|.|||:|.....|.::||.||.||||:|:..|..||:.. ..|....
  Fly  1489 KDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGK-DCLPFLT 1552

  Fly   641 VGYKVEARGFVKVKGKGEMETY 662
            ..|:.|.||.|.||||..||.:
  Fly  1553 NRYEFEPRGSVYVKGKDHMEVF 1574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 9/18 (50%)
Nucleotidyl_cyc_III 488..665 CDD:416391 56/189 (30%)
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485 54/197 (27%)
Guanylate_cyc 1388..1575 CDD:278633 56/192 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454022
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.