DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and rut

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:305 Identity:92/305 - (30%)
Similarity:156/305 - (51%) Gaps:46/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 DSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSL 453
            |:.:....||  :|..|..|.:::..:..||   .||    :..::|:.:::.  |.|.|.::..
  Fly   868 DNRVNASIPL--HLISLARIAIFMIAILVHG---RLV----EGTARLDFLWQL--QASQEKKEMD 921

  Fly   454 ELADSWKRQGDELLYSMIPRPIA-----ERMRKSEEHVCQSFEEVSVIFIEVMNIYD-----SGS 508
            .|.:|.||    :|::::|..:|     .:.|.:.|...||:.:|.|||..|.|..:     .||
  Fly   922 VLQESNKR----ILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGS 982

  Fly   509 NNIQDAMQAVTTLNKVFSALDE---EIISPFVYKVETVGMVYMAVSG--------APDVNPLHAE 562
            :   ..::.:..||::.:..||   |.....:.|::|||..||||.|        ..|.|.:. .
  Fly   983 D---QGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVR-R 1043

  Fly   563 HACDL-----ALR-VMKKVKAHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMES 621
            |...|     |:| .::::.:|:.....:|||||.|||||||:|.:.|:|.::|:|||.||||:|
  Fly  1044 HMTALIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDS 1108

  Fly   622 SSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWLLE 666
            :..|...|::......:....::...||.:||||||:|.||:|.:
  Fly  1109 TGVPGYSQVTQEVVDSLVGSHFEFRCRGTIKVKGKGDMVTYFLCD 1153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 21/94 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 68/198 (34%)
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 6/26 (23%)
CYCc 924..1134 CDD:214485 65/217 (30%)
Guanylate_cyc 954..1151 CDD:278633 68/200 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.