DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Npr3

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:283 Identity:57/283 - (20%)
Similarity:88/283 - (31%) Gaps:112/283 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 LSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGD--------------ELLYSM 470
            ||...:.||:||             :..|......:|.::.:.|:              .|||| 
  Rat   266 LSAGALAAGFQH-------------KDTEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALLYS- 316

  Fly   471 IPRPIAERMRKSEEHVCQSFEEVSVIFIEVMNIYDSGSN--NIQDAMQAVTTLNKVFSALDEEII 533
                    ..|.|.:...:.|.|..:|.| ..::.|..|  ..:|              ||.:.|
  Rat   317 --------DDKLERNCYFTLEGVHEVFQE-EGLHTSAYNFDETKD--------------LDLDDI 358

  Fly   534 SPFVYKVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVAIRVGINSGPVVAGV 598
            ..::...|.|  |.|..||             |...|:|..|..|         |:.||.     
  Rat   359 VRYIQGSERV--VIMCASG-------------DTIRRIMLAVHRH---------GMTSGD----- 394

  Fly   599 VGMKVPRYCLFG-DTVNTASRMESSSDPW-------------MIQLSNYTALKVQKVGYK---VE 646
                   |..|. :..|::|..:.|   |             ...|...|.|:..|..::   :|
  Rat   395 -------YAFFNIELFNSSSYGDGS---WKRGDKHDFEAKQAYSSLQTVTLLRTAKPEFEKFSME 449

  Fly   647 ARGFVKVKGKGEMETY--WLLEG 667
            .:..|:.:|..| |.|  ..:||
  Rat   450 VKSSVEKQGLNE-EDYVNMFVEG 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 13/72 (18%)
Nucleotidyl_cyc_III 488..665 CDD:416391 40/197 (20%)
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 57/283 (20%)
ANF_receptor 182..535 CDD:279440 57/283 (20%)
TM_EphA1 587..618 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.