DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy5

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001012783.3 Gene:Adcy5 / 224129 MGIID:99673 Length:1262 Species:Mus musculus


Alignment Length:320 Identity:100/320 - (31%)
Similarity:166/320 - (51%) Gaps:64/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 ELHGIGLYLN----------DLNPHGLSR-------------------ELVMAGWQHCSKLE--- 436
            |:.|:.|:.|          |.:.:|.|:                   ..|:|.:.|..::|   
Mouse   949 EVPGVTLFDNADLLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTA 1013

  Fly   437 -IMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIA----ERMRKSEEHVCQSFEEVSVI 496
             :.|..:.|.::|.|:..|| .::.|:   ||::::|:.:|    .|.|:::|...||.|.|:|:
Mouse  1014 RLDFLWKLQATEEKEEMEEL-QAYNRR---LLHNILPKDVAAHFLARERRNDELYYQSCECVAVM 1074

  Fly   497 FIEVMNI----YDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY----KVETVGMVYMAVSGA 553
            |..:.|.    .:..:||  :.::.:..||::.:..| ||||...:    |::|:|..|||.||.
Mouse  1075 FASIANFSEFYVELEANN--EGVECLRLLNEIIADFD-EIISEDRFRQLEKIKTIGSTYMAASGL 1136

  Fly   554 PD-----VNPLHAEHACDLALRV---MKKVKAHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFG 610
            .|     ....|.:...|.|:::   ||.:..|:.....:::|:|.|||||||:|.:.|:|.::|
Mouse  1137 NDSTYDKAGKTHIKAIADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG 1201

  Fly   611 DTVNTASRMESSSDPWMIQLSN--YTALKVQKVGYKVEARGFVKVKGKGEMETYWLLEGP 668
            :|||.||||:|:..|..||::.  |..|....  |::|.||.|||||||||.||:|..||
Mouse  1202 NTVNVASRMDSTGVPDRIQVTTDMYQVLAANT--YQLECRGVVKVKGKGEMMTYFLNGGP 1259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 22/111 (20%)
Nucleotidyl_cyc_III 488..665 CDD:416391 72/194 (37%)
Adcy5NP_001012783.3 AC_N 1..459 CDD:292831
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194
CYCc 425..620 CDD:214485
Guanylate_cyc 461..622 CDD:278633
DUF1053 669..761 CDD:283888
CYCc 1037..1238 CDD:214485 66/208 (32%)
Guanylate_cyc 1063..1257 CDD:278633 73/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.