DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy2

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_705762.2 Gene:Adcy2 / 210044 MGIID:99676 Length:1095 Species:Mus musculus


Alignment Length:325 Identity:90/325 - (27%)
Similarity:162/325 - (49%) Gaps:50/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 VGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQ---HC 432
            ||...|||......:.....::|....:.::|..:..:.|.:..:.       |::.|.|   :|
Mouse   775 VGYNIILLHTHAHVLDAYSQVLFQRPGIWKDLKTMGSVSLSIFFIT-------LLVLGRQSEYYC 832

  Fly   433 SKLEIM----FEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAE----RMRKSEEHVCQS 489
             :|:.:    |:||.:..:.:|....:          ||.:::|..:||    |..|:||...||
Mouse   833 -RLDFLWKNKFKKEREEIETMENLNRV----------LLENVLPAHVAEHFLARSLKNEELYHQS 886

  Fly   490 FEEVSVIFIEV---MNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKVETVGMVYM 548
            ::.|.|:|..:   ...|.....| ::.::.:..||::.:..|:.:..|   .|.|::|:|..||
Mouse   887 YDCVCVMFASIPDFKEFYTESDVN-KEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYM 950

  Fly   549 AVSG-----------APDVNPLHAEHACDLALRVMKKVKA---HALPGVAIRVGINSGPVVAGVV 599
            |.:|           .|:...:|.....:.|..::.|:.|   |:.....:|||||.|||:|||:
Mouse   951 AATGLSAVPSQEHAQEPERQYMHIGTMVEFAYALVGKLDAINKHSFNDFKLRVGINHGPVIAGVI 1015

  Fly   600 GMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWL 664
            |.:.|:|.::|:|||.||||:|:.....||::..|:|.:|.:||....||.:.|||||:::||::
Mouse  1016 GAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFV 1080

  Fly   665  664
            Mouse  1081  1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 22/118 (19%)
Nucleotidyl_cyc_III 488..665 CDD:416391 64/197 (32%)
Adcy2NP_705762.2 AC_N <37..264 CDD:292831
CYCc 240..443 CDD:214485
Guanylate_cyc 285..469 CDD:278633
DUF1053 499..603 CDD:283888
CYCc 852..1060 CDD:214485 64/218 (29%)
Guanylate_cyc 882..1081 CDD:278633 64/200 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.