DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and ADCY4

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:334 Identity:100/334 - (29%)
Similarity:170/334 - (50%) Gaps:63/334 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 FYIKDVDSLIFL---CSPLIEN---LDELHGIGLYLNDLNPH-GLSRE----------------L 424
            |.:|.:..|::|   ||..:.:   |.|...:.|||..|:.. |:.:|                |
Human   740 FELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAISFFIFFFTLL 804

  Fly   425 VMAGW-QHCSKLEIMFEK----EEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERM----R 480
            |:|.. ::..:|:.:::|    |.:.::.:|....|          ||.:::|..:|.:.    |
Human   805 VLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL----------LLENVLPAHVAPQFIGQNR 859

  Fly   481 KSEEHVCQSFEEVSVIFIEVMNI--YDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKV 540
            ::|:...||:|.|.|:|..|.:.  :.|.||...:.::.:..||::.:..||.:..|   .|.|:
Human   860 RNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKI 924

  Fly   541 ETVGMVYMAVSG-----APDVNPLHAEHAC-------DLALRVMKK---VKAHALPGVAIRVGIN 590
            :|:|..|||.:|     ..|... .||.:|       :.|:.:..|   :..|:.....:|||:|
Human   925 KTIGSTYMAATGLNATSGQDAQQ-DAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLN 988

  Fly   591 SGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKG 655
            .|||||||:|.:.|:|.::|:|||.||||||:.....||::..||..:|.:||...:||.:||||
Human   989 HGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIKVKG 1053

  Fly   656 KGEMETYWL 664
            ||::.||:|
Human  1054 KGQLCTYFL 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 26/123 (21%)
Nucleotidyl_cyc_III 488..665 CDD:416391 72/197 (37%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831
CYCc 219..422 CDD:214485
Guanylate_cyc 264..418 CDD:278633
DUF1053 479..583 CDD:283888
CYCc 827..1042 CDD:214485 69/225 (31%)
Guanylate_cyc 864..1063 CDD:278633 72/200 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.