DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and gcy-14

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_506660.2 Gene:gcy-14 / 191647 WormBaseID:WBGene00001540 Length:1111 Species:Caenorhabditis elegans


Alignment Length:535 Identity:147/535 - (27%)
Similarity:236/535 - (44%) Gaps:109/535 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 PSVDLNVFLELFPFTI-------------VLDHDMKITLAGEKIVETWILHN-PGVNPKTFIGSH 268
            ||....:.:|....||             .:.||:.:....|:..|...:.| ...|...|||..
 Worm   540 PSTSTKITVESRSETINFIFYYYQQDILAAMKHDLILQFDAEQKAEFRQMRNFDNDNLNKFIGLC 604

  Fly   269 I-------LERFKCRRPKDTQIQWETILQMRTVLFEFELIRTGHNRAAYDAALNFDFENF----- 321
            :       |.|| |.|...:.:..::.:||.: .|.|.|||...|      .|.|...:|     
 Worm   605 LDGPQLFSLWRF-CSRGSLSDVISKSSMQMDS-FFMFSLIRDISN------GLLFIHNSFLKCHG 661

  Fly   322 ---------DEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEIDPATGQRR-----HSVG 372
                     |:...: :.....|.|.:.|  ||.|:| ....|..:.:.....:|.     :|.|
 Worm   662 HLTSRCCLIDDRWQI-KISGYGLKSVRTF--ENPKKE-DLLWTPPENLRNENEERLPEGDIYSFG 722

  Fly   373 L--RSILLKGQMFYIKD----VDSLIFLC-----SPLIENLDELHGIGLYLNDLNPHGLSRELVM 426
            :  ..||.:...|.:::    .|.:|:..     :|:..:||....:     ::||..|  .|:.
 Worm   723 IICSEILTRSSAFDLENRKEKPDVIIYQVKKGGHNPMRPSLDTGETV-----EINPALL--HLIR 780

  Fly   427 AGW-----------------------QHCSKLEIMFEKEEQRSDELEKSL-----ELADSWKRQG 463
            ..|                       :..:.::.:|...|..:..||:.:     ||.:. |::.
 Worm   781 DCWTERPSERPSIEQVRGHLNGMRDGRKSNLMDHVFNMLETYASTLEEEVSDRTKELVEE-KKKS 844

  Fly   464 DELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSAL 528
            |.|||.|:|:.:|::::..:....::||:|::.|.:|:........  ...:|.||.||.:::..
 Worm   845 DVLLYRMLPKMVADKLKLGQTVEPETFEQVTIFFSDVVQFTTLAGK--CTPLQVVTLLNDLYTIF 907

  Fly   529 DEEIISPFVYKVETVGMVYMAVSGAPDVN-PLHAEHACDLALRVMKKV---KAHALPG--VAIRV 587
            |..|....||||||:|..|:.|||.|..| ..|..|...::|..:..:   :...||.  :.:|:
 Worm   908 DGIIEQNDVYKVETIGDGYLCVSGLPHRNGNEHIRHIARMSLGFLSSLEFFRVQHLPSERINLRI 972

  Fly   588 GINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKV--GYKVEARGF 650
            |||.|.|||||||:.:||||||||.|||||||||:..|..|.::......:.:|  |::.|:||.
 Worm   973 GINCGSVVAGVVGLTMPRYCLFGDAVNTASRMESNGKPGKIHVTAEANQMLTQVVGGFRTESRGE 1037

  Fly   651 VKVKGKGEMETYWLL 665
            |.:||||.|||||||
 Worm  1038 VIIKGKGVMETYWLL 1052

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 69/339 (20%)
Nucleotidyl_cyc_III 488..665 CDD:416391 76/184 (41%)
gcy-14NP_506660.2 PBP1_NPR_GC_like 21..423 CDD:107347
ANF_receptor 43..418 CDD:279440
PKc_like 535..800 CDD:304357 55/278 (20%)
HNOBA <817..860 CDD:285003 13/43 (30%)
CYCc 839..1031 CDD:214485 71/194 (37%)
Guanylate_cyc 866..1053 CDD:278633 78/189 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.