DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and gcy-1

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:696 Identity:178/696 - (25%)
Similarity:281/696 - (40%) Gaps:201/696 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 FTYP-KMKSPSMQLTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYG----LDMTAYVLESQ 168
            |||. .:..|::.|...|:.|||..|                      ||    ||:        
 Worm   441 FTYTNSVMVPNVTLFYKDEGGAVWSY----------------------YGHSRPLDI-------- 475

  Fly   169 NDICG--GTAGPIKLTE----------------------GPLTVIVKYRLDFD--NRDYMAKRVN 207
             .|||  |.:.|:...|                      |.|.||...|.:..  |.::......
 Worm   476 -PICGFLGKSCPVSFWEQYKILIFVAIAVIVLMVLIMIIGCLCVISGKRAERARINAEWQVPFAK 539

  Fly   208 VIAHPSQLK-----------MPSVD--------LNVFLELFPFTIVLDHDMKITLA--------- 244
            :|....|::           .||:.        ::.|.|.:.. ::.:.:|.:|..         
 Worm   540 LIESEKQVRGKGASRRSLQSAPSISTGHSGVTTVSDFCENYTM-MMYEKEMVLTAKYQYTHLTKA 603

  Fly   245 -GEKIVETWILHNPGVNPKTFIG-----SHILERFK-CRRPKDTQIQWETILQMRTVLFEFELIR 302
             .|:.|:...|.:..:|  .|||     :|.:...| |.|.....|.......| ...|.|.:||
 Worm   604 DKERFVKMRKLDHENIN--RFIGLSIDSAHFISVTKLCSRGSLQDILSRGNFSM-DYFFMFCIIR 665

  Fly   303 TGHNRAAYDAALNFDF---------ENFDEASSL-NEAQAMALASAKEFSAENAKE--------- 348
                    |.|...::         .|...|:.| |::..:.||   |:..:|..|         
 Worm   666 --------DVAKGLEYLHKTFLRLHGNLRSATCLVNDSWQVKLA---EYGMDNLVEEQTPPKKRL 719

  Fly   349 -----EAAAAATSKDEIDPATGQRRHSVGLRSILLKGQMFYIKD--VDSLIFLCSPLIENLDELH 406
                 |....:.|..:::|:......::....||.|.:.:.|.|  .|     |..::.|:.:  
 Worm   720 LWVAPEVLRGSLSVSQMEPSADIYSFAIIASEILTKKEAWDILDRKED-----CEEIVYNVKK-- 777

  Fly   407 GIGLY---------LNDLNPHGLSRELVMAGWQH-----------CSKLEIMFEKE--------- 442
            | ||:         ::|:||..::  ||...|..           ||:::.:..|:         
 Worm   778 G-GLFPIRPEIITDIHDVNPALIA--LVKDCWAEVPEDRPTAENICSQMKGLVSKQKTNLMDHVF 839

  Fly   443 ----------EQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSVIF 497
                      |:..:|..|.|.|.   |::.|.||..|:|:.:|||::..:....:.|:.|:|.|
 Worm   840 NMLEEYTSTLEEEIEERTKELTLE---KKKADILLSRMLPKQVAERLKAGQTVEPEGFDSVTVFF 901

  Fly   498 IEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVNP-LHA 561
            .:|:......|.  ....|.|..||.::|..|..|....|||||::|..|:.|||.|..|. .|.
 Worm   902 SDVVKFTILASK--CSPFQTVNLLNDLYSNFDTIIEQHGVYKVESIGDGYLCVSGLPTRNGYAHI 964

  Fly   562 EHACDLALRVMKKVKAHALP-----GVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMES 621
            :...|::|:.|:..|:..:|     .|.:|:|:||||.||||||:.:||||||||||||||||||
 Worm   965 KQIVDMSLKFMEYCKSFNIPHLPRENVELRIGVNSGPCVAGVVGLSMPRYCLFGDTVNTASRMES 1029

  Fly   622 SSDPWMIQLSN--YTALKVQKVG-YKVEARGFVKVKGKGEMETYWL 664
            :..|.:|.|:|  ::.|...... |:..:||.|.:||||.|||:|:
 Worm  1030 NGKPSLIHLTNDAHSLLTTHYPNQYETSSRGEVIIKGKGVMETFWV 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167 14/56 (25%)
HNOBA 218..479 CDD:400168 70/349 (20%)
Nucleotidyl_cyc_III 488..665 CDD:416391 79/186 (42%)
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347 3/7 (43%)
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357 54/290 (19%)
HNOBA <840..883 CDD:285003 13/45 (29%)
CYCc 862..1051 CDD:214485 77/193 (40%)
Guanylate_cyc 889..1077 CDD:278633 79/189 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.