DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and acy-4

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_504486.4 Gene:acy-4 / 178949 WormBaseID:WBGene00000071 Length:1013 Species:Caenorhabditis elegans


Alignment Length:256 Identity:76/256 - (29%)
Similarity:112/256 - (43%) Gaps:58/256 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 WKRQG-DELLYSMIPRPIAERMRKSEE-----------HVCQSFEEVSVIFIEVMNIYDSGSNNI 511
            ||.|. ||.|         :..||.|:           ||.:.|.|.:.   .|..:|....:|.
 Worm   763 WKLQALDEQL---------QMKRKHEQNRSVLENILPSHVAKHFVEDAT---SVSKLYHESRDNA 815

  Fly   512 QDAMQAVTTLNKVFSALD------------EEIISPF---------------VYKVETVGMVYMA 549
            ......:|..:|.:...|            .||||.|               :.|::|:...||.
 Worm   816 CIMFATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTYMV 880

  Fly   550 VSGAPD---VNPLHAEHACDLALRVMKKVKA---HALPGVAIRVGINSGPVVAGVVGMKVPRYCL 608
            .||...   .:..|.|.....|..::.|:::   |:.....:|:|||.|||||||:|...|.|.:
 Worm   881 ASGLAGRECGDNSHVEAIALFARELLVKLESTNIHSFNNFNLRIGINVGPVVAGVIGSDKPHYDI 945

  Fly   609 FGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWLLEGPE 669
            :|::||.||||:|......||::......::.:||..|.||.:.|||||.|||::||. ||
 Worm   946 WGNSVNVASRMDSGGVAGRIQVTEEVKSILEPLGYNFECRGQINVKGKGMMETFFLLP-PE 1005

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 6/20 (30%)
Nucleotidyl_cyc_III 488..665 CDD:416391 61/209 (29%)
acy-4NP_504486.4 AC_N <50..291 CDD:292831
CYCc 260..451 CDD:214485
Guanylate_cyc 293..448 CDD:278633
CYCc 778..984 CDD:214485 53/208 (25%)
Guanylate_cyc 807..1003 CDD:278633 59/195 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.