DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and gcy-29

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:245 Identity:74/245 - (30%)
Similarity:127/245 - (51%) Gaps:20/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 LEIMFEKEEQRSDELEKSL----ELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVSV 495
            ::.|....|:.::.|||.:    :||:....:.:.||:.::|:.:|..::.......:.::..:|
 Worm   813 VDSMMRMMEEYANNLEKLVGERTKLAEEANLRAERLLFQLLPKHVAIELKAGRTVAPKMYDSATV 877

  Fly   496 IFIEVMNIYDSGSNNIQDA---MQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN 557
            :|.:::     |...:..|   ::.|..|||::|..|..|.....|||||:|..||.|||.|..|
 Worm   878 MFSDIV-----GFTKLCSASTPIEVVNLLNKLYSEFDTVISKHDCYKVETIGDAYMVVSGIPIEN 937

  Fly   558 -PLHAEHACDLALRVMKKVKAHALP-----GVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTA 616
             ..|..:...:.|.:|..:|...:|     .:.||:|..||.|.|.|||:..|||||||:|||.|
 Worm   938 GQRHVANISAVTLGIMDLLKVFEVPHRRDYRLTIRLGFASGQVSAAVVGLSSPRYCLFGETVNIA 1002

  Fly   617 SRMESSSDPWMIQLSNYTALKVQK--VGYKVEARGFVKVKGKGEMETYWL 664
            :.||||.:...:|::..:.:.::.  ..:.:|.||..|...:.:..||||
 Worm  1003 AVMESSGEGGRVQITETSKILLENEYPEFIIEIRGINKDVKQDDFVTYWL 1052

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 11/47 (23%)
Nucleotidyl_cyc_III 488..665 CDD:416391 63/188 (34%)
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665
CYCc 840..1033 CDD:214485 59/197 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.