DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and gc2

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_021333059.1 Gene:gc2 / 140425 ZFINID:ZDB-GENE-011128-8 Length:1120 Species:Danio rerio


Alignment Length:243 Identity:94/243 - (38%)
Similarity:142/243 - (58%) Gaps:20/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 QHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVS 494
            |:.|.||   |...:|::|||  :|     |::.::||..|:|..:||.::.......:.||.||
Zfish   830 QYSSNLE---ELIRERTEELE--IE-----KQKTEKLLTQMLPPSVAEALKLGTTVEPEHFESVS 884

  Fly   495 VIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN-P 558
            :.|.:::......:|:  :.::.|..||.:::..|..|.:..||||||:|..||..||.|..| .
Zfish   885 LYFSDIVGFTTISANS--EPIEVVDLLNDLYTTFDAVIGNHDVYKVETIGDAYMVASGVPVPNGN 947

  Fly   559 LHAEHACDLALRVMKKV---KAHALPG--VAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASR 618
            .||....::||.::..|   :...:|.  |.||:|:::||.||||||:.:||||||||||.||||
Zfish   948 RHAAEIANMALDILSAVGTFRMRHMPDVPVRIRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASR 1012

  Fly   619 MESSSDPWMIQLSNYTA--LKVQKVGYKVEARGFVKVKGKGEMETYWL 664
            |||:..|:.|.:.:.|.  |...|:||:||.|...::|||...|||||
Zfish  1013 MESTGLPYRIHVHSSTVKILMELKLGYRVELRARTELKGKRIEETYWL 1060

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 17/48 (35%)
Nucleotidyl_cyc_III 488..665 CDD:416391 77/185 (42%)
gc2XP_021333059.1 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..815 CDD:270945
HNOBA <824..869 CDD:311573 17/48 (35%)
CYCc 848..1040 CDD:214485 73/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.