DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and gucy2f

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:244 Identity:94/244 - (38%)
Similarity:144/244 - (59%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 QHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSEEHVCQSFEEVS 494
            |:.|.||.:.   .:|::|||..       |::.::||..|:|..:||.::.......:.|::|:
Zfish   831 QYSSNLEDLI---RERTEELEVE-------KQRTEKLLSEMLPPSVAEALKTGASVEPEYFDQVT 885

  Fly   495 VIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSGAPDVN-P 558
            :.|.:::..  :..:::.|.::.|..||.::|..|..:.|..||||||:|..||..||.|..| .
Zfish   886 IYFSDIVGF--TTISSLSDPIEVVDLLNDLYSLFDAVLGSHDVYKVETIGDAYMVASGLPKKNGN 948

  Fly   559 LHAEHACDLALRVMKKV---KAHALP--GVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASR 618
            .||....:::|.::..|   |...:|  .|.||:||:|||.||||||:.:|||||||||||||||
Zfish   949 KHAAEIANMSLNILSSVGSFKMRHMPEVPVRIRIGIHSGPCVAGVVGLTMPRYCLFGDTVNTASR 1013

  Fly   619 MESSSDPWMI--QLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWLL 665
            |||:..|:.|  .:|....|:....|||::.||..::||||..|||||:
Zfish  1014 MESTGLPYRIHVNISTVQILRSLNDGYKIDVRGKTELKGKGIEETYWLV 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 15/48 (31%)
Nucleotidyl_cyc_III 488..665 CDD:416391 78/184 (42%)
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945
HNOBA <825..870 CDD:311573 15/48 (31%)
CYCc 850..1042 CDD:214485 74/200 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.