DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and Adcy6

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_006520366.3 Gene:Adcy6 / 11512 MGIID:87917 Length:1254 Species:Mus musculus


Alignment Length:374 Identity:115/374 - (30%)
Similarity:186/374 - (49%) Gaps:92/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 FENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEID-PATGQRRHSVGLRSILLKGQ 381
            |:|:|....::     .|||:.|               :.|.:| ||.|:         :.||  
Mouse   948 FDNYDLLLGVH-----GLASSNE---------------TFDGLDCPAVGR---------VALK-- 981

  Fly   382 MFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRS 446
              |:..|..|:|             .:.|||:.......:|...:  |    ||:...||||.  
Mouse   982 --YMTPVILLVF-------------ALALYLHAQQVESTARLDFL--W----KLQATGEKEEM-- 1023

  Fly   447 DELEKSLELADSWKRQGDELLYSMIPRPIA----ERMRKSEEHVCQSFEEVSVIFIEVMNI---- 503
            :||:       ::.|:   ||::::|:.:|    .|.|:::|...||.|.|:|:|..:.|.    
Mouse  1024 EELQ-------AYNRR---LLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFY 1078

  Fly   504 YDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY----KVETVGMVYMAVSGA-----PDVNPL 559
            .:..:||  :.::.:..||::.:..| ||||...:    |::|:|..|||.||.     ..|...
Mouse  1079 VELEANN--EGVECLRLLNEIIADFD-EIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRS 1140

  Fly   560 HAEHACDLALRVMKKVK---AHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMES 621
            |.....|.|:|:|:::|   .|:.....:::|:|.|||||||:|.:.|:|.::|:|||.:|||:|
Mouse  1141 HITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDS 1205

  Fly   622 SSDPWMIQLSN--YTALKVQKVGYKVEARGFVKVKGKGEMETYWLLEGP 668
            :..|..||::.  |..|..:  ||::|.||.|||||||||.||:|..||
Mouse  1206 TGVPDRIQVTTDLYQVLAAK--GYQLECRGVVKVKGKGEMTTYFLNGGP 1252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 36/165 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 73/194 (38%)
Adcy6XP_006520366.3 AC_N 83..454 CDD:318454
Guanylate_cyc 456..640 CDD:306677
DUF1053 668..754 CDD:368844
Guanylate_cyc 1056..1250 CDD:306677 74/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.