DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and ADCY9

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_005255136.1 Gene:ADCY9 / 115 HGNCID:240 Length:1372 Species:Homo sapiens


Alignment Length:329 Identity:93/329 - (28%)
Similarity:144/329 - (43%) Gaps:52/329 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 VGLRSILLKGQMFYIKDVDSLIFLC---SPLIENLDELHGIGLYLNDLN---PHGLSRELVMAG- 428
            ||...:||    .|:.       ||   |.|...||.:.......|..|   |..|.|...:.| 
Human   946 VGAGPLLL----LYVS-------LCPDSSVLTSPLDAVQNFSSERNPCNSSVPRDLRRPASLIGQ 999

  Fly   429 -------------WQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR 480
                         |....:.|:.:........|.:.......|.:.|.|.||.::||..:||:::
Human  1000 EVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLK 1064

  Fly   481 KSEEHVCQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKVET 542
            .|:.: .::.:...|||..::|..:....|.:...:....||::....||.:..|   .:.|::|
Human  1065 VSQTY-SKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKT 1128

  Fly   543 VGMVYMAVSGAPDVNPLHA-------EHACDL------ALRVMKKVKAHAL-PGVAIRVGINSGP 593
            :|..|||.||   :|...|       ||...|      .:||:.....:.| ....:|||.|.||
Human  1129 IGATYMAASG---LNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGP 1190

  Fly   594 VVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGE 658
            :.|||:|.....|.::|||||.||||:::.....||:|..:...:.|:||..:.||.|.|||||:
Human  1191 LTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQ 1255

  Fly   659 METY 662
            |:||
Human  1256 MKTY 1259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 29/127 (23%)
Nucleotidyl_cyc_III 488..665 CDD:416391 63/192 (33%)
ADCY9XP_005255136.1 DUF2339 <118..>301 CDD:287113
CYCc 326..544 CDD:214485
Guanylate_cyc 385..573 CDD:278633
CYCc 1043..1243 CDD:214485 61/203 (30%)
Guanylate_cyc 1069..1260 CDD:278633 63/195 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.