DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and ADCY6

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001377760.1 Gene:ADCY6 / 112 HGNCID:237 Length:1168 Species:Homo sapiens


Alignment Length:374 Identity:115/374 - (30%)
Similarity:186/374 - (49%) Gaps:92/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 FENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEID-PATGQRRHSVGLRSILLKGQ 381
            |:|:|....::     .|||:.|               :.|.:| ||.|:         :.||  
Human   862 FDNYDLLLGVH-----GLASSNE---------------TFDGLDCPAAGR---------VALK-- 895

  Fly   382 MFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRS 446
              |:..|..|:|             .:.|||:.......:|...:  |    ||:...||||.  
Human   896 --YMTPVILLVF-------------ALALYLHAQQVESTARLDFL--W----KLQATGEKEEM-- 937

  Fly   447 DELEKSLELADSWKRQGDELLYSMIPRPIA----ERMRKSEEHVCQSFEEVSVIFIEVMNI---- 503
            :||:       ::.|:   ||::::|:.:|    .|.|:::|...||.|.|:|:|..:.|.    
Human   938 EELQ-------AYNRR---LLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFY 992

  Fly   504 YDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY----KVETVGMVYMAVSGA-----PDVNPL 559
            .:..:||  :.::.:..||::.:..| ||||...:    |::|:|..|||.||.     ..|...
Human   993 VELEANN--EGVECLRLLNEIIADFD-EIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRS 1054

  Fly   560 HAEHACDLALRVMKKVK---AHALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMES 621
            |.....|.|:|:|:::|   .|:.....:::|:|.|||||||:|.:.|:|.::|:|||.:|||:|
Human  1055 HITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDS 1119

  Fly   622 SSDPWMIQLSN--YTALKVQKVGYKVEARGFVKVKGKGEMETYWLLEGP 668
            :..|..||::.  |..|..:  ||::|.||.|||||||||.||:|..||
Human  1120 TGVPDRIQVTTDLYQVLAAK--GYQLECRGVVKVKGKGEMTTYFLNGGP 1166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 36/165 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 73/194 (38%)
ADCY6NP_001377760.1 AC_N <16..368 CDD:318454
Guanylate_cyc 370..554 CDD:306677
DUF1053 582..668 CDD:399378
Guanylate_cyc 970..1164 CDD:306677 74/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.