DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and ADCY5

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens


Alignment Length:270 Identity:94/270 - (34%)
Similarity:154/270 - (57%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 VMAGWQHCSKLE----IMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIA----ERMRK 481
            |:|.:.|..::|    :.|..:.|.::|.|:..|| .::.|:   ||::::|:.:|    .|.|:
Human  1023 VLALYLHAQQVESTARLDFLWKLQATEEKEEMEEL-QAYNRR---LLHNILPKDVAAHFLARERR 1083

  Fly   482 SEEHVCQSFEEVSVIFIEVMNI----YDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY---- 538
            ::|...||.|.|:|:|..:.|.    .:..:||  :.::.:..||::.:..| ||||...:    
Human  1084 NDELYYQSCECVAVMFASIANFSEFYVELEANN--EGVECLRLLNEIIADFD-EIISEDRFRQLE 1145

  Fly   539 KVETVGMVYMAVSGAPD-----VNPLHAEHACDLALRV---MKKVKAHALPGVAIRVGINSGPVV 595
            |::|:|..|||.||..|     |...|.:...|.|:::   ||.:..|:.....:::|:|.||||
Human  1146 KIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVV 1210

  Fly   596 AGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSN--YTALKVQKVGYKVEARGFVKVKGKGE 658
            |||:|.:.|:|.::|:|||.||||:|:..|..||::.  |..|....  |::|.||.||||||||
Human  1211 AGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANT--YQLECRGVVKVKGKGE 1273

  Fly   659 METYWLLEGP 668
            |.||:|..||
Human  1274 MMTYFLNGGP 1283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 15/61 (25%)
Nucleotidyl_cyc_III 488..665 CDD:416391 73/194 (38%)
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454
Guanylate_cyc 460..633 CDD:306677
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677 74/198 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.