DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and ADCY2

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_065433.2 Gene:ADCY2 / 108 HGNCID:233 Length:1091 Species:Homo sapiens


Alignment Length:325 Identity:91/325 - (28%)
Similarity:164/325 - (50%) Gaps:50/325 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 VGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGLSRELVMAGWQ---HC 432
            ||..:|||......:.|...::|....:.::|..:..:.|.:..:.       |::.|.|   :|
Human   771 VGYNTILLHTHAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFIT-------LLVLGRQNEYYC 828

  Fly   433 SKLEIM----FEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAE----RMRKSEEHVCQS 489
             :|:.:    |:||.:..:.:|....:          ||.:::|..:||    |..|:||...||
Human   829 -RLDFLWKNKFKKEREEIETMENLNRV----------LLENVLPAHVAEHFLARSLKNEELYHQS 882

  Fly   490 FEEVSVIFIEV---MNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISP---FVYKVETVGMVYM 548
            ::.|.|:|..:   ...|.....| ::.::.:..||::.:..|:.:..|   .|.|::|:|..||
Human   883 YDCVCVMFASIPDFKEFYTESDVN-KEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYM 946

  Fly   549 AVSG-----------APDVNPLHAEHACDLALRVMKKVKA---HALPGVAIRVGINSGPVVAGVV 599
            |.:|           .|:...:|.....:.|..::.|:.|   |:.....:|||||.|||:|||:
Human   947 AATGLSAVPSQEHSQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVI 1011

  Fly   600 GMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWL 664
            |.:.|:|.::|:|||.||||:|:.....||::..|:|.:|.:||....||.:.|||||:::||::
Human  1012 GAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFV 1076

  Fly   665  664
            Human  1077  1076

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 23/118 (19%)
Nucleotidyl_cyc_III 488..665 CDD:416391 64/197 (32%)
ADCY2NP_065433.2 AC_N <33..260 CDD:292831
CYCc 236..439 CDD:214485
Guanylate_cyc 281..465 CDD:278633
DUF1053 495..599 CDD:283888
CYCc 848..1056 CDD:214485 64/218 (29%)
Guanylate_cyc 878..1077 CDD:278633 64/200 (32%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 905..922 3/17 (18%)
Interaction with GNAS. /evidence=ECO:0000250|UniProtKB:P26769 990..993 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.