DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyc89Db and ADCY1

DIOPT Version :9

Sequence 1:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:267 Identity:82/267 - (30%)
Similarity:132/267 - (49%) Gaps:41/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 HCSKLEIMF--------EKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKSE---- 483
            |..:::|..        :.||:|.| :||.       |.....:|::::|..:|:....|.    
Human   801 HARQVDIRLRLDYLWAAQAEEERED-MEKV-------KLDNRRILFNLLPAHVAQHFLMSNPRNM 857

  Fly   484 EHVCQSFEEVSVIFIEVMNIYD----SGSNNIQDAMQAVTTLNKVFSALDEEIISPF---VYKVE 541
            :...||:.:|.|:|..:.|..|    ...||:  .::.:..||::.:..||.:...|   :.|::
Human   858 DLYYQSYSQVGVMFASIPNFNDFYIELDGNNM--GVECLRLLNEIIADFDELMEKDFYKDIEKIK 920

  Fly   542 TVGMVYMAVSG-APDVN-------PLHAEHACDLALR---VMKKVKAHALPGVAIRVGINSGPVV 595
            |:|..|||..| ||...       ..|.....|.|:.   |:.::...:.....:|||||.||||
Human   921 TIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVV 985

  Fly   596 AGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEME 660
            |||:|.:.|:|.::|:|||.||||:|:.....||::......:::..|....||.|.|||||||.
Human   986 AGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHRLLRRCPYHFVCRGKVSVKGKGEML 1050

  Fly   661 TYWLLEG 667
            ||: |||
Human  1051 TYF-LEG 1056

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 12/55 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 66/194 (34%)
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831
CYCc 258..453 CDD:214485
Guanylate_cyc 294..476 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 493..520
CYCc 826..1037 CDD:214485 61/219 (28%)
Guanylate_cyc 859..1056 CDD:278633 67/199 (34%)
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.